PDGFA/PDGFB (Human) Recombinant Protein
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human PDGFA/PDGFB (P01127|P04085) recombinant protein expressed in Escherichia coli.
Sequence
PDGFA:MSIEEAVPAVCKTRTVIYEIPRSQVDPTSANFLIWPPCVEVKRCTGCCNTSSVKCQPSRVHHRSVKVAKVEYVRKKPKLKEVQVRLEEHLECACATTSLNPDYREEDTGRPRESGKKRKRKRLKPT.
_x005F_x005F_x005F_x000D__x005F_x000D_ PDGFB: SLGSLTIAEPAMIAECKTRTEVFEISRRLIDRTNANFLVWPPCVEVQRCSGCCNNRNVQCRPTQVQLRPVQVRKIGIVRKKPIFKKATVTLGDHLACKCETVAAARPVT.Host
Escherichia coli
Theoretical MW (kDa)
26.4
Form
Lyophilized
Preparation Method
Escherichia coli expression system
Purity
> 95% by SDS-PAGE
Activity
The ED50 as determined by the dose-dependent proliferation of mouse 3T3 indicator cells, is 1.4-2.1 ng/mL. This corresponds to a specific activity of 7.1x 105 units/mg.
Storage Buffer
Lyophilized from 10mM AcOH
Storage Instruction
Lyophilized although stable at room temperature for 3 weeks, should be stored desiccated below -20°C. Upon reconstitution should be stored at 4°C between 2-7 days and for future use below -20°C.
Aliquot to avoid repeated freezing and thawing._x005F_x005F_x005F_x000D__x005F_x000D_ For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). -
Applications
Functional Study
SDS-PAGE
-
Gene Info — PDGFA
Entrez GeneID
5154Protein Accession#
P01127|P04085Gene Name
PDGFA
Gene Alias
PDGF-A, PDGF1
Gene Description
platelet-derived growth factor alpha polypeptide
Omim ID
173430Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a member of the platelet-derived growth factor family. The four members of this family are mitogenic factors for cells of mesenchymal origin and are characterized by a motif of eight cysteines. This gene product can exist either as a homodimer or as a heterodimer with the platelet-derived growth factor beta polypeptide, where the dimers are connected by disulfide bonds. Studies using knockout mice have shown cellular defects in oligodendrocytes, alveolar smooth muscle cells, and Leydig cells in the testis; knockout mice die either as embryos or shortly after birth. Two splice variants have been identified for this gene. [provided by RefSeq
Other Designations
PDGF A-chain|platelet-derived growth factor alpha|platelet-derived growth factor alpha chain|platelet-derived growth factor alpha isoform 2 preproprotein
-
Gene Info — PDGFB
Entrez GeneID
5155Protein Accession#
P01127|P04085Gene Name
PDGFB
Gene Alias
FLJ12858, PDGF2, SIS, SSV, c-sis
Gene Description
platelet-derived growth factor beta polypeptide (simian sarcoma viral (v-sis) oncogene homolog)
Omim ID
190040Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a member of the platelet-derived growth factor family. The four members of this family are mitogenic factors for cells of mesenchymal origin and are characterized by a motif of eight cysteines. This gene product can exist either as a homodimer (PDGF-BB) or as a heterodimer with the platelet-derived growth factor alpha polypeptide (PDGF-AB), where the dimers are connected by disulfide bonds. Mutations in this gene are associated with meningioma. Reciprocal translocations between chromosomes 22 and 7, at sites where this gene and that for COL1A1 are located, are associated with a particular type of skin tumor called dermatofibrosarcoma protuberans resulting from unregulated expression of growth factor. Two alternatively spliced transcript variants encoding different isoforms have been identified for this gene. [provided by RefSeq
Other Designations
PDGF, B chain|Platelet-derived growth factor, beta polypeptide (oncogene SIS)|becaplermin|oncogene SIS|platelet-derived growth factor 2|platelet-derived growth factor beta|platelet-derived growth factor, B chain|v-sis platelet-derived growth factor beta p
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com