TNFSF15 (Human) Recombinant Protein
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
SDS-PAGE analysis of TNFSF15 (Human) Recombinant Protein.
Result of activity analysis
Result of activity analysis
-
Specification
Product Description
Human TNFSF15 (O95150, 72 a.a. - 251 a.a.) partial recombinant protein with His tag expressed in Escherichia coli.
Sequence
LKGQEFAPSHQQVYAPLRADGDKPRAHLTVVRQTPTQHFKNQFPALHWEHELGLAFTKNRMNYTNKFLLIPESGDYFIYSQVTFRGMTSECSEIRQAGRPNKPDSITVVITKVTDSYPEPTQLLMGTKSVCEVGSNWFQPIYLGAMFSLQEGDKLMVNVSDISLVDYTKEDKTFFGAFLL
Host
Escherichia coli
Theoretical MW (kDa)
22.7
Form
Liquid
Preparation Method
Escherichia coli expression system
Purity
> 90% as analyzed by SDS-PAGE.
Endotoxin Level
< 1 EU/ug of protein by the LAL method.
Activity
ED50 < 100 ng/mL, measured by the ability to induce apoptosis in TF-1 human erythroleukemic cells in the presence of cycloheximaide.
Quality Control Testing
SDS-PAGE Stained with Coomassie Blue.
SDS-PAGE analysis of TNFSF15 (Human) Recombinant Protein.
Recommend Usage
Biological Activity
SDS-PAGE
The optimal working dilution should be determined by the end user.Storage Buffer
In 20mM Tris-HCl buffer, 0.15M NaCl, pH 8.5 (40% glycerol)
Storage Instruction
Store at 4°C for 1 week. For long term storage store at -20°C to -80°C.
Aliquot to avoid repeated freezing and thawing.Note
Result of activity analysis
-
Applications
Functional Study
SDS-PAGE
-
Gene Info — TNFSF15
Entrez GeneID
9966Protein Accession#
O95150Gene Name
TNFSF15
Gene Alias
MGC129934, MGC129935, TL1, TL1A, VEGI, VEGI192A
Gene Description
tumor necrosis factor (ligand) superfamily, member 15
Omim ID
604052Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a cytokine that belongs to the tumor necrosis factor (TNF) ligand family. This protein is abundantly expressed in endothelial cells, but is not expressed in either B or T cells. The expression of this protein is inducible by TNF and IL-1 alpha. This cytokine is a ligand for receptor TNFRSF25 and decoy receptor TNFRSF21/DR6. It can activate NF-kappaB and MAP kinases, and acts as an autocrine factor to induce apoptosis in endothelial cells. This cytokine is also found to inhibit endothelial cell proliferation, and thus may function as an angiogenesis inhibitor. An additional isoform encoded by an alternatively spliced transcript variant has been reported but the sequence of this transcript has not been determined. [provided by RefSeq
Other Designations
OTTHUMP00000022739|TNF ligand-related molecule 1|TNF superfamily ligand TL1A|vascular endothelial cell growth inhibitor|vascular endothelial growth inhibitor-192A
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com