IL10 (Human) Recombinant Protein
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human IL10 recombinant protein with polyhistidine tag at the C-terminus expressed in Escherichia coli.
Sequence
MSPGQGTQSENSCTHFPGNLPNMLRDLRDAFSRVKTFFQMKDQLDNLLLKESLLEDFKGYLGCQALSEMIQFYLEEVMPQAENQDPDIKAHVNSLGENLKTLRLRLRRCHRFLPCENKSKAVEQVKNAFNKLQEKGIYKAMSEFDIFINYIEAYMTMKIRN
Host
Escherichia coli
Form
Lyophilized
Preparation Method
Escherichia coli expression system
Purification
Ni-NTA chromatography
Purity
> 98% as determined by SDS-PAGE analysis.
Endotoxin Level
< 0.01 EU per 1 ug of the protein by the LAL method.
Activity
The ED50 for this effect is < 1 ng/mL, measured by the induction of MC/9-2 cells proliferation. The specific activity of recombinant human IL-10 is approximately > 1 x 106 IU/ mg.
Quality Control Testing
SDS-PAGE Stained with Coomassie Blue
Recommend Usage
SDS-PAGE
The optimal working dilution should be determined by the end user.Storage Buffer
Lyophilized from a solution containing 1X PBS, pH 8.0.
Reconstitute the lyophilized protein in sterile H2O to a concentration of at least 0.5 mg/mL and incubate the stock solution for at least 20 min to ensure sufficient redissolution. Please use the protein within one month after reconstitution.Storage Instruction
Store at -20°C, lyophilized protein is stable for 1 year.
After reconstitution with deionized water, store at -20 to -80°C.
Aliquot to avoid repeated freezing and thawing. -
Applications
Functional Study
The ED50 for this effect is <1 ng/mL, measured by the induction of MC/9-2 cells proliferation.SDS-PAGE
-
Gene Info — IL10
Entrez GeneID
3586Gene Name
IL10
Gene Alias
CSIF, IL-10, IL10A, MGC126450, MGC126451, TGIF
Gene Description
interleukin 10
Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a cytokine produced primarily by monocytes and to a lesser extent by lymphocytes. This cytokine has pleiotropic effects in immunoregulation and inflammation. It down-regulates the expression of Th1 cytokines, MHC class II Ags, and costimulatory molecules on macrophages. It also enhances B cell survival, proliferation, and antibody production. This cytokine can block NF-kappa B activity, and is involved in the regulation of the JAK-STAT signaling pathway. Knockout studies in mice suggested the function of this cytokine as an essential immunoregulator in the intestinal tract. [provided by RefSeq
Other Designations
cytokine synthesis inhibitory factor
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com