TNFRSF1A (Human) Recombinant Protein
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human TNFRSF1A recombinant protein expressed in Escherichia coli.
Sequence
MDSVCPQGKYIHPQNNSICCTKCHKGTYLYNDCPGPGQDTDCRECESGSFTASENHLRHCLSCSKCRKEMGQVEISSCTVDRDTVCGCKNQYRHYWSENLFQCFNCSLCLNGTVHLSCQEKQNTVCTCHAGFFLRENECVSCSNCKKSLECTKLCLPQIEN
Host
Escherichia coli
Theoretical MW (kDa)
20.9
Form
Lyophilized
Preparation Method
Escherichia coli expression system
Endotoxin Level
< 0.1 EU/ug
Activity
The activity is determined by the ability to inhibit the cytolysis 1 ng/mL TNFα has on mouse L929 cells in the presence of Actinomycin D. The expected ED50 for this effect is 8-12 ng/mL.
Quality Control Testing
1 ug/lane in 4-20% Tris-Glycine gel Stained with Coomassie Blue
Lane 1: non-reducing conditions
Lane 2: reducing conditionsStorage Buffer
Lyophilized with 10 mM Na2PO4, pH 7.5.
Storage Instruction
Store at -20°C on dry atmosphere.
After reconstitution with sterilized water, store at -20°C.
Aliquot to avoid repeated freezing and thawing.Note
Result of activity analysis
-
Applications
Functional Study
SDS-PAGE
-
Gene Info — TNFRSF1A
Entrez GeneID
7132Gene Name
TNFRSF1A
Gene Alias
CD120a, FPF, MGC19588, TBP1, TNF-R, TNF-R-I, TNF-R55, TNFAR, TNFR1, TNFR55, TNFR60, p55, p55-R, p60
Gene Description
tumor necrosis factor receptor superfamily, member 1A
Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a member of the TNF-receptor superfamily. This protein is one of the major receptors for the tumor necrosis factor-alpha. This receptor can activate NF-kappaB, mediate apoptosis, and function as a regulator of inflammation. Antiapoptotic protein BCL2-associated athanogene 4 (BAG4/SODD) and adaptor proteins TRADD and TRAF2 have been shown to interact with this receptor, and thus play regulatory roles in the signal transduction mediated by the receptor. Germline mutations of the extracellular domains of this receptor were found to be associated with the autosomal dominant periodic fever syndrome. The impaired receptor clearance is thought to be a mechanism of the disease. [provided by RefSeq
Other Designations
tumor necrosis factor binding protein 1|tumor necrosis factor receptor 1|tumor necrosis factor receptor type 1|tumor necrosis factor-alpha receptor
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com