BRCC2 MaxPab mouse polyclonal antibody (B01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length human BRCC2 protein.
Immunogen
BRCC2 (NP_001001786.1, 1 a.a. ~ 108 a.a) full-length human protein.
Sequence
MVTLLPIEGQEVHFFEILESECVLYTGWIERASGSSIYPEAKARLPLEALLGSNKEPMLPKETVLSLKRYNLGSSAMKRNVPGHVLQRPSYLTRIQVTLLCNSSAEAL
Host
Mouse
Reactivity
Human
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
No additive
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Note
For IHC and IF applications, antibody purification with Protein A will be needed prior to use.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of BLID expression in transfected 293T cell line (H00414899-T01) by BLID MaxPab polyclonal antibody.
Lane 1: BRCC2 transfected lysate(11.88 KDa).
Lane 2: Non-transfected lysate.
Immunofluorescence
Immunofluorescence of purified MaxPab antibody to BRCC2 on HeLa cell. [antibody concentration 10 ug/ml] -
Gene Info — BLID
Entrez GeneID
414899GeneBank Accession#
NM_001001786.1Protein Accession#
NP_001001786.1Gene Name
BLID
Gene Alias
BRCC2, BRCC@, MGC163233, MGC163235
Gene Description
BH3-like motif containing, cell death inducer
Omim ID
608853Gene Ontology
HyperlinkGene Summary
This gene encodes a BH3-like motif containing protein involved in cell death. The encoded protein may induce apoptosis in a caspase-dependent manner. The protein is localized in both the cytoplasm and the mitochondrion. [SH
Other Designations
BRCC2 mRNA|BRCC2 protein|breast cancer cell 2
-
Disease
-
Publication Reference
-
Hypoxia-induced gene expression results from selective mRNA partitioning to the endoplasmic reticulum.
Jonas J Staudacher, Isabel S Naarmann-de Vries, Stefanie J Ujvari, Bertram Klinger, Mumtaz Kasim, Edgar Benko, Antje Ostareck-Lederer, Dirk H Ostareck, Anja Bondke Persson, Stephan Lorenzen, Jochen C Meier, Nils Blüthgen, Pontus B Persson, Alexandra Henrion-Caude, Ralf Mrowka, Michael Fahling.
Nucleic Acids Research 2015 Mar; 43(6):3219.
Application:WB-Ce, Human, HT-1080 cells.
-
Hypoxia-induced gene expression results from selective mRNA partitioning to the endoplasmic reticulum.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com