SALF monoclonal antibody (M01), clone 5F12
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Tissue lysate)
SALF monoclonal antibody (M01), clone 5F12. Western Blot analysis of STON1-GTF2A1L expression in human pancreas.
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged SALF is approximately 0.03ng/ml as a capture antibody.
Western Blot detection against Immunogen (37.73 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant SALF.
Immunogen
SALF (NP_758515, 141 a.a. ~ 249 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
SCTHPTPKVGLPDEVNPQQAESLGFQSDDLPQFQYFREDCAFSSPFWKDEGSDSHFTLDPPGSKKMFSSRNKEMPIDQKSLNKCSLNYICEKLEHLQSAENQDSLRSLS
Host
Mouse
Reactivity
Human
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37.73 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
SALF monoclonal antibody (M01), clone 5F12. Western Blot analysis of STON1-GTF2A1L expression in human pancreas.Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged SALF is approximately 0.03ng/ml as a capture antibody.ELISA
-
Gene Info — STON1-GTF2A1L
Entrez GeneID
286749GeneBank Accession#
NM_172311Protein Accession#
NP_758515Gene Name
STON1-GTF2A1L
Gene Alias
MGC126821, MGC126823, SALF
Gene Description
STON1-GTF2A1L readthrough transcript
Gene Ontology
HyperlinkGene Summary
The STON1-GTF2A1L mRNA is an infrequent but naturally occurring co-transcribed product of the neighboring STON1 and GTF2A1L genes. This rare transcript encodes a fusion protein composed of greater than 95% each of the individual elements, stonin 1 and general transcription factor IIA, 1-like. The significance of this co-transcribed mRNA and the function of its protein product have not yet been determined. [provided by RefSeq
Other Designations
OTTHUMP00000159452|STON1-GTF2A1L protein|stoned B/TFIIA alpha/beta like factor|stoned B/TFIIA-alpha/beta-like factor
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com