KSR2 monoclonal antibody (M08), clone 1G4
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant KSR2.
Immunogen
KSR2 (NP_775869, 411 a.a. ~ 500 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
PAPPLPPSATPPSPLHPSPQCTRQQKNFNLPASHYYKYKQQFIFPDVVPVPETPTRAPQVILHPVTSNPILEGNPLLQIEVEPTSENEEV
Host
Mouse
Reactivity
Human
Isotype
IgG2b Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (35.53 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
KSR2 monoclonal antibody (M08), clone 1G4. Western Blot analysis of KSR2 expression in A-431.Western Blot (Transfected lysate)
Western Blot analysis of KSR2 expression in transfected 293T cell line by KSR2 monoclonal antibody (M08), clone 1G4.
Lane 1: KSR2 transfected lysate (Predicted MW: 93.6 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged KSR2 is approximately 0.03ng/ml as a capture antibody.ELISA
RNAi Knockdown (Antibody validated)
Western blot analysis of KSR2 over-expressed 293 cell line, cotransfected with KSR2 Validated Chimera RNAi ( Cat # H00283455-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with KSR2 monoclonal antibody (M08) clone 1G4 (Cat # H00283455-M08 ). GAPDH ( 36.1 kDa ) used as specificity and loading control. -
Gene Info — KSR2
-
Interactome
-
Disease
-
Publication Reference
-
KSR2-14-3-3ζ complex serves as a biomarker and potential therapeutic target in sorafenib-resistant hepatocellular carcinoma.
Chao Gao, Si-Wei Wang, Jia-Cheng Lu, Xiao-Qiang Chai, Yuan-Cheng Li, Peng-Fei Zhang, Xiao-Yong Huang, Jia-Bin Cai, Yi-Min Zheng, Xiao-Jun Guo, Guo-Ming Shi, Ai-Wu Ke, Jia Fan.
Biomarker Research 2022 Apr; 10(1):25.
Application:WB-Ce, WB-Ti, WB-Tr, Human, Hep3B, HepG2, HuH7 cells, Human liver, MHCC97H, PLC/PRF/5 cells.
-
A novel antiproliferative PKCα-Ras-ERK signaling axis in intestinal epithelial cells.
Navneet Kaur, Michelle A Lum, Robert E Lewis, Adrian R Black, Jennifer D Black.
The Journal of Biological Chemistry 2022 Jul; 298(7):102121.
Application:WB-Ce, WB-Ti, Human, Rat, IEC-18 cells, Rat brain.
-
G protein-coupled Estrogen Receptor 1 (GPER1)/GPR30 Increases ERK1/2 Activity Through PDZ-dependent and -independent Mechanisms.
Gonzalez de Valdivia E, Broselid S, Kahn R, Olde B, Leeb-Lundberg LMF.
Amino Acids 2017 Apr; 292(24):9932.
Application:WB-Tr, Human, HEK 293T cells.
-
Kinase suppressor of Ras 2 (KSR2) regulates tumor cell transformation via AMPK.
Fernandez MR, Henry MD, Lewis RE.
Molecular and Cellular Biology 2012 Sep; 32(18):3718.
Application:WB, Human, Mouse , HEK 293T cells, MEFs.
-
KSR2 is an essential regulator of AMP kinase, energy expenditure, and insulin sensitivity.
Costanzo-Garvey DL, Pfluger PT, Dougherty MK, Stock JL, Boehm M, Chaika O, Fernandez MR, Fisher K, Kortum RL, Hong EG, Jun JY, Ko HJ, Schreiner A, Volle DJ, Treece T, Swift AL, Winer M, Chen D, Wu M, Leon LR, Shaw AS, McNeish J, Kim JK, Morrison DK, Tscho.
Cell Metabolism 2009 Nov; 10(5):366.
Application:WB-Ti, WB-Tr, Human, Mouse, HEK 293T cells, Mouse brains, NG108-15 cells.
-
KSR2-14-3-3ζ complex serves as a biomarker and potential therapeutic target in sorafenib-resistant hepatocellular carcinoma.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com