NUT monoclonal antibody (M03), clone 8B1
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
C15orf55 monoclonal antibody (M03), clone 8B1. Western Blot analysis of C15orf55 expression in NIH/3T3.
Western Blot (Cell lysate)
C15orf55 monoclonal antibody (M03), clone 8B1. Western Blot analysis of C15orf55 expression in Hela S3 NE.
Western Blot (Cell lysate)
C15orf55 monoclonal antibody (M03), clone 8B1. Western Blot analysis of C15orf55 expression in PC-12.
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged C15orf55 is 0.03 ng/ml as a capture antibody.
Western Blot detection against Immunogen (36.74 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant NUT.
Immunogen
NUT (NP_786883.1, 1033 a.a. ~ 1132 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
REHPLSPHHASGGQGSQRASHLLPAGAKGPSKLPYPVAKSGKRALAGGPAPTEKTPHSGAQLGVPREKPLALGVVRPSQPRKRRCDSFVTGRRKKRRRSQ
Host
Mouse
Reactivity
Human, Mouse, Rat
Interspecies Antigen Sequence
Mouse (51); Rat (54)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.74 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
C15orf55 monoclonal antibody (M03), clone 8B1. Western Blot analysis of C15orf55 expression in NIH/3T3.Western Blot (Cell lysate)
C15orf55 monoclonal antibody (M03), clone 8B1. Western Blot analysis of C15orf55 expression in Hela S3 NE.Western Blot (Cell lysate)
C15orf55 monoclonal antibody (M03), clone 8B1. Western Blot analysis of C15orf55 expression in PC-12.Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged C15orf55 is 0.03 ng/ml as a capture antibody.ELISA
-
Gene Info — C15orf55
Entrez GeneID
256646GeneBank Accession#
NM_175741Protein Accession#
NP_786883.1Gene Name
C15orf55
Gene Alias
DKFZp434O192, MGC138683, MGC138684, NUT
Gene Description
chromosome 15 open reading frame 55
Omim ID
608963Gene Ontology
HyperlinkOther Designations
nuclear protein in testis
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com