EBF3 monoclonal antibody (M05), clone 8D6
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant EBF3.
Immunogen
EBF3 (NP_001005463, 381 a.a. ~ 480 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
LYGMPHNNQEIILKRAADIAEALYSVPRNHNQIPTLGNNPAHTGMMGVNSFSSQLAVNVSETSQANDQVGYSRNTSSVSPRGYVPSSTPQQSNYNTVSTS
Host
Mouse
Reactivity
Human, Mouse
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.74 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
EBF3 monoclonal antibody (M05), clone 8D6. Western Blot analysis of EBF3 expression in NIH/3T3 ( Cat # L018V1 ).Western Blot (Cell lysate)
EBF3 monoclonal antibody (M05), clone 8D6 Western Blot analysis of EBF3 expression in IMR-32 ( Cat # L008V1 ).Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to EBF3 on formalin-fixed paraffin-embedded human lymph node. [antibody concentration 0.3 ug/ml]Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged EBF3 is approximately 0.03ng/ml as a capture antibody.ELISA
-
Gene Info — EBF3
Entrez GeneID
253738GeneBank Accession#
NM_001005463Protein Accession#
NP_001005463Gene Name
EBF3
Gene Alias
COE3, O/E-2
Gene Description
early B-cell factor 3
Omim ID
607407Gene Ontology
HyperlinkOther Designations
OTTHUMP00000020743
-
Disease
-
Publication Reference
-
A high-risk retinoblastoma subtype with stemness features, dedifferentiated cone states and neuronal/ganglion cell gene expression.
Jing Liu, Daniela Ottaviani, Meriem Sefta, Céline Desbrousses, Elodie Chapeaublanc, Rosario Aschero, Nanor Sirab, Fabiana Lubieniecki, Gabriela Lamas, Laurie Tonon, Catherine Dehainault, Clément Hua, Paul Fréneaux, Sacha Reichman, Narjesse Karboul, Anne Biton, Liliana Mirabal-Ortega, Magalie Larcher, Céline Brulard, Sandrine Arrufat, André Nicolas, Nabila Elarouci, Tatiana Popova, Fariba Némati, Didier Decaudin, David Gentien, Sylvain Baulande, Odette Mariani, Florent Dufour, Sylvain Guibert, Cé
Nature Communications 2021 Sep; 12(1):5578.
Application:IHC-P, Human, Human normal retina, Human retinoblastomas.
-
Single-cell RNA sequencing reveals midbrain dopamine neuron diversity emerging during mouse brain development.
Tiklová K, Björklund ÅK, Lahti L, Fiorenzano A, Nolbrant S, Gillberg L, Volakakis N, Yokota C, Hilscher MM, Hauling T, Holmström F, Joodmardi E, Nilsson M, Parmar M, Perlmann T.
Nature Communications 2019 Feb; 10(1):581.
Application:IHC-Fr, Human, Human embryos.
-
The Transcription Factors EBF1 and EBF2 Are Positive Regulators of Myelination in Schwann Cells.
Moruzzo D, Nobbio L, Sterlini B, Consalez GG, Benfenati F, Schenone A, Corradi A.
Molecular Neurobiology 2017 Dec; 54(10):8117.
Application:WB, Rat, Dorsal root ganglia (DRG) myelinating cultures.
-
Differential effects of a polyalanine tract expansion in Arx on neural development and gene expression.
Nasrallah MP, Cho G, Putt ME, Kitamura K, Golden JA.
Human Molecular Genetics 2012 Mar; 21(5):1090.
Application:IF, Mouse, Brain.
-
A high-risk retinoblastoma subtype with stemness features, dedifferentiated cone states and neuronal/ganglion cell gene expression.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com