NEIL2 monoclonal antibody (M01), clone 1B7
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of NEIL2 expression in transfected 293T cell line by NEIL2 monoclonal antibody (M01), clone 1B7.
Lane 1: NEIL2 transfected lysate(36.8 KDa).
Lane 2: Non-transfected lysate.
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged NEIL2 is approximately 1ng/ml as a capture antibody.
RNAi Knockdown (Antibody validated)
Western blot analysis of NEIL2 over-expressed 293 cell line, cotransfected with NEIL2 Validated Chimera RNAi ( Cat # H00252969-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with NEIL2 monoclonal antibody (M01), clone 1B7 (Cat # H00252969-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.
Western Blot detection against Immunogen (62.26 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a full length recombinant NEIL2.
Immunogen
NEIL2 (AAH13964, 1 a.a. ~ 332 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MPEGPLVRKFHHLVSPFVGQQVVKTGGSSKKLQPASLQSLWLQDTQVHGKKLFLRFDLDEEMGPPGSSPTPEPPQKEVQKEGAADPKQVGEPSGQKTLDGSSRSAELVPQGEDDSEYLERDAPAGDAGRWLRVSFGLFGSVWVNDFSRAKKANKRGDWRDPSPRLVLHFGGGGFLAFYNCQLSWSSSPVVTPTCDILSEKFHRGQALEALGQAQPVCYTLLDQRYFSGLGNIIKNEALYRAGIHPLSLGSVLSASRREVLVDHVVEFSTAWLQGKFQGRPQHTQVYQKEQCPAGHQVMKEAFGPEDGLQRLTWWCPQCQPQLSEEPEQCQFS
Host
Mouse
Reactivity
Human
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (62.26 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of NEIL2 expression in transfected 293T cell line by NEIL2 monoclonal antibody (M01), clone 1B7.
Lane 1: NEIL2 transfected lysate(36.8 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged NEIL2 is approximately 1ng/ml as a capture antibody.ELISA
RNAi Knockdown (Antibody validated)
Western blot analysis of NEIL2 over-expressed 293 cell line, cotransfected with NEIL2 Validated Chimera RNAi ( Cat # H00252969-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with NEIL2 monoclonal antibody (M01), clone 1B7 (Cat # H00252969-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control. -
Gene Info — NEIL2
Entrez GeneID
252969GeneBank Accession#
BC013964Protein Accession#
AAH13964Gene Name
NEIL2
Gene Alias
FLJ31644, MGC2832, MGC4505, NEH2, NEI2
Gene Description
nei like 2 (E. coli)
Omim ID
608933Gene Ontology
HyperlinkGene Summary
NEIL2 belongs to a class of DNA glycosylases homologous to the bacterial Fpg/Nei family. These glycosylases initiate the first step in base excision repair by cleaving bases damaged by reactive oxygen species and introducing a DNA strand break via the associated lyase reaction (Bandaru et al., 2002 [PubMed 12509226])[supplied by OMIM
Other Designations
OTTHUMP00000116006|nei-like 2
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com