C9orf96 monoclonal antibody (M03), clone 2B5
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of C9orf96 expression in transfected 293T cell line by C9orf96 monoclonal antibody (M03), clone 2B5.
Lane 1: C9orf96 transfected lysate(75.5 KDa).
Lane 2: Non-transfected lysate.
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged C9orf96 is approximately 0.03ng/ml as a capture antibody.
RNAi Knockdown (Antibody validated)
Western blot analysis of C9orf96 over-expressed 293 cell line, cotransfected with C9orf96 Validated Chimera RNAi ( Cat # H00169436-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with C9orf96 monoclonal antibody (M03), clone 2B5 (Cat # H00169436-M03 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.
Western Blot detection against Immunogen (36.63 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant C9orf96.
Immunogen
C9orf96 (NP_714921, 1 a.a. ~ 99 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MLGPGSNRRRPTQGERGPGSPGEPMEKYQVLYQLNPGALGVNLVVEEMETKVKHVIKQVECMDDHYASQALEELMPLLKLRHAHISVYQELFITWNGEI
Host
Mouse
Reactivity
Human
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.63 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of C9orf96 expression in transfected 293T cell line by C9orf96 monoclonal antibody (M03), clone 2B5.
Lane 1: C9orf96 transfected lysate(75.5 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged C9orf96 is approximately 0.03ng/ml as a capture antibody.ELISA
RNAi Knockdown (Antibody validated)
Western blot analysis of C9orf96 over-expressed 293 cell line, cotransfected with C9orf96 Validated Chimera RNAi ( Cat # H00169436-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with C9orf96 monoclonal antibody (M03), clone 2B5 (Cat # H00169436-M03 ). GAPDH ( 36.1 kDa ) used as specificity and loading control. -
Gene Info — C9orf96
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com