NEK10 monoclonal antibody (M01), clone 1C9
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
NEK10 monoclonal antibody (M01), clone 1C9. Western Blot analysis of NEK10 expression in Raw 264.7 ( Cat # L024V1 ).
Western Blot (Cell lysate)
NEK10 monoclonal antibody (M01), clone 1C9. Western Blot analysis of NEK10 expression in NIH/3T3 ( Cat # L018V1 ).
Western Blot (Cell lysate)
NEK10 monoclonal antibody (M01), clone 1C9 Western Blot analysis of NEK10 expression in HeLa ( Cat # L013V1 ).
Western Blot (Transfected lysate)
Western Blot analysis of NEK10 expression in transfected 293T cell line by NEK10 monoclonal antibody (M01), clone 1C9.
Lane 1: NEK10 transfected lysate(53.1 KDa).
Lane 2: Non-transfected lysate.
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged NEK10 is approximately 0.03ng/ml as a capture antibody.
Immunofluorescence
Immunofluorescence of monoclonal antibody to NEK10 on HeLa cell. [antibody concentration 10 ug/ml]
Western Blot detection against Immunogen (35.64 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant NEK10.
Immunogen
NEK10 (NP_689747, 211 a.a. ~ 300 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
RYFMEANRNTVTCHHELAVLSHETFEKASLSSSSSGAASLKSELSESADLPPEGFQASYGKDEDRACDEILSDDNFNLENAEKDTYSEVD
Host
Mouse
Reactivity
Human, Mouse
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (35.64 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
NEK10 monoclonal antibody (M01), clone 1C9. Western Blot analysis of NEK10 expression in Raw 264.7 ( Cat # L024V1 ).Western Blot (Cell lysate)
NEK10 monoclonal antibody (M01), clone 1C9. Western Blot analysis of NEK10 expression in NIH/3T3 ( Cat # L018V1 ).Western Blot (Cell lysate)
NEK10 monoclonal antibody (M01), clone 1C9 Western Blot analysis of NEK10 expression in HeLa ( Cat # L013V1 ).Western Blot (Transfected lysate)
Western Blot analysis of NEK10 expression in transfected 293T cell line by NEK10 monoclonal antibody (M01), clone 1C9.
Lane 1: NEK10 transfected lysate(53.1 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged NEK10 is approximately 0.03ng/ml as a capture antibody.ELISA
Immunofluorescence
Immunofluorescence of monoclonal antibody to NEK10 on HeLa cell. [antibody concentration 10 ug/ml] -
Gene Info — NEK10
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com