NFAM1 (Human) Recombinant Protein (Q01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human NFAM1 partial ORF ( NP_666017.1, 187 a.a. - 269 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
NKKRMRGPGKDPTRKCPDPRSASSPKQHPSESVYTALQRRETEVYACIENEDGSSPTAKQSPLSQERPHRFEDDGELNLVYEN
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
34.87
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — NFAM1
Entrez GeneID
150372GeneBank Accession#
NM_145912Protein Accession#
NP_666017.1Gene Name
NFAM1
Gene Alias
CNAIP, FLJ40652, bK126B4.4
Gene Description
NFAT activating protein with ITAM motif 1
Omim ID
608740Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a type I membrane receptor that activates cytokine gene promoters such as the IL-13 and TNF-alpha promoters. The encoded protein contains an immunoreceptor tyrosine-based activation motif (ITAM) and is thought to regulate the signaling and development of B-cells. [provided by RefSeq
Other Designations
NFAT activation molecule 1|OTTHUMP00000028683|calcinerin/NFAT-activating ITAM-containing protein
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com