MOBKL2C purified MaxPab mouse polyclonal antibody (B01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Tissue lysate)
MOBKL2C MaxPab polyclonal antibody. Western Blot analysis of MOBKL2C expression in human pancreas.
Western Blot (Transfected lysate)
Western Blot analysis of MOBKL2C expression in transfected 293T cell line (H00148932-T01) by MOBKL2C MaxPab polyclonal antibody.
Lane 1: MOBKL2C transfected lysate(23.76 KDa).
Lane 2: Non-transfected lysate.
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length human MOBKL2C protein.
Immunogen
MOBKL2C (NP_958805.1, 1 a.a. ~ 216 a.a) full-length human protein.
Sequence
MALCLKQVFAKDKTFRPRKRFEPGTQRFELYKKAQASLKSGLDLRSVVRLPPGENIDDWIAVHVVDFFNRINLIYGTMAERCSETSCPVMAGGPRYEYRWQDERQYRRPAKLSAPRYMALLMDWIEGLINDEEVFPTRVGVPFPKNFQQVCTKILTRLFRVFVHVYIHHFDSILSMGAEAHVNTCYKHFYYFIREFSLVDQRELEPLREMTERICH
Host
Mouse
Reactivity
Human
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
MOBKL2C MaxPab polyclonal antibody. Western Blot analysis of MOBKL2C expression in human pancreas.Western Blot (Transfected lysate)
Western Blot analysis of MOBKL2C expression in transfected 293T cell line (H00148932-T01) by MOBKL2C MaxPab polyclonal antibody.
Lane 1: MOBKL2C transfected lysate(23.76 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — MOBKL2C
Entrez GeneID
148932GeneBank Accession#
NM_201403.1Protein Accession#
NP_958805.1Gene Name
MOBKL2C
Gene Alias
MGC26743, MOB3C
Gene Description
MOB1, Mps One Binder kinase activator-like 2C (yeast)
Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is similar to the yeast Mob1 protein. Yeast Mob1 binds Mps1p, a protein kinase essential for spindle pole body duplication and mitotic checkpoint regulation. Alternatively spliced transcript variants encoding distinct isoforms have been observed. [provided by RefSeq
Other Designations
MOB1, Mps One Binder kinase activator-like 2C|OTTHUMP00000009682
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com