ACTRT2 monoclonal antibody (M03), clone 2E10
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant ACTRT2.
Immunogen
ACTRT2 (NP_536356, 209 a.a. ~ 299 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
DKGLVDDIKKKLCYVALEPEKELSRRPEEVLREYKLPDGNIISLGDPLHQAPEALFVPQQLGSQSPGLSNMVSSSITKCDTDIQKILFGEI
Host
Mouse
Reactivity
Human
Isotype
IgG2a Lambda
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (35.75 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
ACTRT2 monoclonal antibody (M03), clone 2E10. Western Blot analysis of ACTRT2 expression in HepG2 ( Cat # L019V1 ).Western Blot (Transfected lysate)
Western Blot analysis of ACTRT2 expression in transfected 293T cell line by ACTRT2 monoclonal antibody (M03), clone 2E10.
Lane 1: ACTRT2 transfected lysate(41.7 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to ACTRT2 on formalin-fixed paraffin-embedded human colon. [antibody concentration 3 ug/ml]ELISA
-
Gene Info — ACTRT2
Entrez GeneID
140625GeneBank Accession#
NM_080431Protein Accession#
NP_536356Gene Name
ACTRT2
Gene Alias
ARPM2, ARPT2, Arp-T2, FLJ25424, HARPM2
Gene Description
actin-related protein T2
Omim ID
608535Gene Ontology
HyperlinkGene Summary
The protein encoded by this intronless gene belongs to the actin family. Studies have shown that this protein may be involved in cytoskeletal organization similar to other cytoplasmic actin-related protein (ARP) subfamily members. Antibody raised against the human protein has been used to detect the protein by immunoblotting and immunofluorescence microscopy, demonstrating its specific synthesis in the testis, late in spermatid differentiation, and its localization in the calyx. [provided by RefSeq
Other Designations
OTTHUMP00000000569|actin-related protein M2|actin-related protein hArpM2
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com