TWIST2 purified MaxPab rabbit polyclonal antibody (D01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Rabbit polyclonal antibody raised against a full-length human TWIST2 protein.
Immunogen
TWIST2 (NP_476527.1, 1 a.a. ~ 160 a.a) full-length human protein.
Sequence
MEEGSSSPVSPVDSLGTSEEELERQPKRFGRKRRYSKKSSEDGSPTPGKRGKKGSPSAQSFEELQSQRILANVRERQRTQSLNEAFAALRKIIPTLPSDKLSKIQTLKLAARYIDFLYQVLQSDEMDNKMTSCSYVAHERLSYAFSVWRMEGAWSMSASH
Host
Rabbit
Reactivity
Human
Interspecies Antigen Sequence
Mouse (100); Rat (100)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of TWIST2 expression in transfected 293T cell line (H00117581-T02) by TWIST2 MaxPab polyclonal antibody.
Lane 1: TWIST2 transfected lysate(18.10 KDa).
Lane 2: Non-transfected lysate.
Immunofluorescence
Immunofluorescence of purified MaxPab antibody to TWIST2 on HeLa cell. [antibody concentration 10 ug/ml] -
Gene Info — TWIST2
Entrez GeneID
117581GeneBank Accession#
NM_057179.1Protein Accession#
NP_476527.1Gene Name
TWIST2
Gene Alias
DERMO1, MGC117334, bHLHa39
Gene Description
twist homolog 2 (Drosophila)
Omim ID
607556Gene Ontology
HyperlinkGene Summary
Basic helix-loop-helix (bHLH) transcription factors have been implicated in cell lineage determination and differentiation. The protein encoded by this gene is a bHLH transcription factor and shares similarity with another bHLH transcription factor, Twist. It is thought that during osteoblast development this protein may inhibit osteoblast maturation and maintain cells in a preosteoblast phenotype. [provided by RefSeq
Other Designations
dermis-expressed protein 1|twist homolog 2|twist-related bHLH protein Dermo1
-
Interactome
-
Publication Reference
-
Twist2 contributes to termination of limb bud outgrowth and patterning through direct regulation of Grem1.
Wade C, Brinas I, Welfare M, Wicking C, Farlie PG.
Developmental Biology 2012 Oct; 370(1):145.
Application:ChIP, Chicken, E4.5 limb buds.
-
Twist2 contributes to termination of limb bud outgrowth and patterning through direct regulation of Grem1.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com