FOXP4 monoclonal antibody (M01), clone 3B12
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant FOXP4.
Immunogen
FOXP4 (NP_001012426.1, 586 a.a. ~ 679 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
LNSPGMLNPGSASSLLPLSHDDVGAPVEPLPSNGSSSPPRLSPPQYSHQVQVKEEPAEAEEDRQPGPPLGAPNPSASGPPEDRDLEEELPGEEL
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (91); Rat (92)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.08 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of FOXP4 expression in transfected 293T cell line by FOXP4 monoclonal antibody (M01), clone 3B12.
Lane 1: FOXP4 transfected lysate(73.2 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
ELISA
-
Gene Info — FOXP4
Entrez GeneID
116113GeneBank Accession#
NM_001012426Protein Accession#
NP_001012426.1Gene Name
FOXP4
Gene Alias
FLJ40908, FLJ44184, hFKHLA
Gene Description
forkhead box P4
Omim ID
608924Gene Ontology
HyperlinkGene Summary
This gene belongs to subfamily P of the forkhead box (FOX) transcription factor family. Forkhead box transcription factors play important roles in the regulation of tissue- and cell type-specific gene transcription during both development and adulthood. Many members of the forkhead box gene family, including members of subfamily P, have roles in mammalian oncogenesis. This gene may play a role in the development of tumors of the kidney and larynx. Alternative splicing of this gene produces multiple transcript variants, some encoding different isoforms. [provided by RefSeq
Other Designations
OTTHUMP00000016374|OTTHUMP00000039784|OTTHUMP00000043412|OTTHUMP00000043536|fork head-related protein like A|winged-helix repressor FOXP4
-
Interactome
-
Disease
-
Publication Reference
-
Convergent repression of Foxp2 3'UTR by miR-9 and miR-132 in embryonic mouse neocortex: implications for radial migration of neurons.
Clovis YM, Enard W, Marinaro F, Huttner WB, De Pietri Tonelli D.
Development 2012 Sep; 139(18):3332.
Application:IF, Mouse, Mouse cortex.
-
Convergent repression of Foxp2 3'UTR by miR-9 and miR-132 in embryonic mouse neocortex: implications for radial migration of neurons.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com