OSBPL8 monoclonal antibody (M02), clone 4H6
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
OSBPL8 monoclonal antibody (M02), clone 4H6. Western Blot analysis of OSBPL8 expression in Jurkat ( Cat # L017V1 ).
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged OSBPL8 is 0.3 ng/ml as a capture antibody.
Western Blot detection against Immunogen (37.07 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant OSBPL8.
Immunogen
OSBPL8 (NP_065892.1, 244 a.a. ~ 346 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
IIRATSESDGRCWMDALELALKCSSLLKRTMIREGKEHDLSVSSDSTHVTFYGLLRANNLHSGDNFQLNDSEIERQHFKDQDMYSDKSDKENDQEHDESDNEV
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (96)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37.07 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
OSBPL8 monoclonal antibody (M02), clone 4H6. Western Blot analysis of OSBPL8 expression in Jurkat ( Cat # L017V1 ).Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged OSBPL8 is 0.3 ng/ml as a capture antibody.ELISA
-
Gene Info — OSBPL8
Entrez GeneID
114882GeneBank Accession#
NM_020841Protein Accession#
NP_065892.1Gene Name
OSBPL8
Gene Alias
DKFZp686A11164, MGC126578, MGC133203, MST120, MSTP120, ORP8, OSBP10
Gene Description
oxysterol binding protein-like 8
Omim ID
606736Gene Ontology
HyperlinkGene Summary
This gene encodes a member of the oxysterol-binding protein (OSBP) family, a group of intracellular lipid receptors. Like most members, the encoded protein contains an N-terminal pleckstrin homology domain and a highly conserved C-terminal OSBP-like sterol-binding domain. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq
Other Designations
OSBP-related protein 8|oxysterol-binding protein-like protein 8|oxysterol-binding protein-related protein 8
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com