ADAT3 purified MaxPab mouse polyclonal antibody (B01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length human ADAT3 protein.
Immunogen
ADAT3 (NP_612431, 1 a.a. ~ 351 a.a) full-length human protein.
Sequence
MEPAPGLVEQPKCLEAGSPEPEPAPWQALPVLSEKQSGDVELVLAYAAPVLDKRQTSRLLKEVSALHPLPAQPHLKRVRPSRDAGSPHALEMLLCLAGPASGPRSLAELLPRPAVDPRGLGQPFLVPVPARPPLTRGQFEEARAHWPTSFHEDKQVTSALAGRLFSTQERAAMQSHMERAVWAARRAAARGLRAVGAVVVDPASDRVLATGHDCSCADNPLLHAVMVCVDLVARGQGRGTYDFRPFPACSFAPAAAPQAVRAGAVRKLDADEDGLPYLCTGYDLYVTREPCAMCAMALVHARILRVFYGAPSPDGALGTRFRIHARPDLNHRFQVFRGVLEEQCRWLDPDT
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (81); Rat (81)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of ADAT3 expression in transfected 293T cell line by ADAT3 MaxPab polyclonal antibody.
Lane 1: ADAT3 transfected lysate(38.61 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — ADAT3
Entrez GeneID
113179GeneBank Accession#
NM_138422Protein Accession#
NP_612431Gene Name
ADAT3
Gene Alias
FWP005, MST121, MSTP121, S863-5, TAD3
Gene Description
adenosine deaminase, tRNA-specific 3, TAD3 homolog (S. cerevisiae)
Gene Ontology
HyperlinkGene Summary
tRNA-specific 3
Other Designations
tRNA-specific adenosine deaminase 3|tRNA-specific adenosine deaminase 3 homolog
-
Interactome
-
Publication Reference
-
Identification and rescue of a tRNA wobble inosine deficiency causing intellectual disability disorder.
Jillian Ramos, Melissa Proven, Jonatan Halvardson, Felix Hagelskamp, Ekaterina Kuchinskaya, Ben Phelan, Ryan Bell, Stefanie Kellner, Lars Feuk, Ann-Charlotte Thuresson, Dragony Fu.
RNA 2020 Nov; 26(11):1654.
Application:WB-Tr, Human, HEK 293T cells, Human skin fibroblasts.
-
Formation of tRNA wobble inosine in humans is disrupted by a millennia-old mutation causing intellectual disability.
Ramos J, Han L, Li Y, Hagelskamp F, Kellner SM, Alkuraya FS, Phizicky EM, Fu D.
Molecular and Cellular Biology 2019 Sep; 39(19):e00203.
Application:IF, Human, Human lymphoblastoid cells.
-
Identification and rescue of a tRNA wobble inosine deficiency causing intellectual disability disorder.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com