H2AFV monoclonal antibody (M08), clone 2F9
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to H2AFV on formalin-fixed paraffin-embedded human placenta. [antibody concentration 3 ug/ml]
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged H2AFV is 0.03 ng/ml as a capture antibody.
Immunofluorescence
Immunofluorescence of monoclonal antibody to H2AFV on HeLa cell . [antibody concentration 10 ug/ml]
-
Specification
Product Description
Mouse monoclonal antibody raised against a full-length recombinant H2AFV.
Immunogen
H2AFV (AAH00098, 1 a.a. ~ 128 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MAGGKAGRDSGKAKAKAVSRSQRAGLQFPVGRIHRHLKTRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDSLIKATIAGGGVIPHIHKSLIGKKGQQKTA
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (99); Rat (99)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to H2AFV on formalin-fixed paraffin-embedded human placenta. [antibody concentration 3 ug/ml]Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged H2AFV is 0.03 ng/ml as a capture antibody.ELISA
Immunofluorescence
Immunofluorescence of monoclonal antibody to H2AFV on HeLa cell . [antibody concentration 10 ug/ml] -
Gene Info — H2AFV
Entrez GeneID
94239GeneBank Accession#
BC000098Protein Accession#
AAH00098Gene Name
H2AFV
Gene Alias
FLJ26479, H2AV, MGC10170, MGC10831, MGC1947
Gene Description
H2A histone family, member V
Gene Ontology
HyperlinkGene Summary
Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. Nucleosomes consist of approximately 146 bp of DNA wrapped around a histone octamer composed of pairs of each of the four core histones (H2A, H2B, H3, and H4). The chromatin fiber is further compacted through the interaction of a linker histone, H1, with the DNA between the nucleosomes to form higher order chromatin structures. This gene encodes a member of the histone H2A family. Several transcript variants encoding different isoforms, have been identified for this gene. [provided by RefSeq
Other Designations
histone H2A.F/Z|purine-rich binding element protein B
-
Interactome
-
Pathway
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com