MGC21874 monoclonal antibody (M08), clone 1C8
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant MGC21874.
Immunogen
MGC21874 (XP_291105, 2 a.a. ~ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
AELGKKYCVYCLAEVSPLRFRCTECQDIELCPECFSAGAEIGHHRRYHGYQLVDGGRFTLWGPEAEGGWTSREEQLLLDAIEQFGFGNWEDMAAHVGASRTPQEVMEHY
Host
Mouse
Reactivity
Human, Mouse, Rat
Interspecies Antigen Sequence
Mouse (99); Rat (99)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37.73 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
MGC21874 monoclonal antibody (M08), clone 1C8. Western Blot analysis of MGC21874 expression in Raw 264.7 ( Cat # L024V1 ).Western Blot (Cell lysate)
MGC21874 monoclonal antibody (M08), clone 1C8. Western Blot analysis of MGC21874 expression in PC-12 ( Cat # L012V1 ).Western Blot (Cell lysate)
MGC21874 monoclonal antibody (M08), clone 1C8 Western Blot analysis of MGC21874 expression in HeLa ( Cat # L013V1 ).Western Blot (Cell lysate)
MGC21874 monoclonal antibody (M08), clone 1C8. Western Blot analysis of MGC21874 expression in NIH/3T3 ( Cat # L018V1 ).Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to MGC21874 on formalin-fixed paraffin-embedded human stomach. [antibody concentration 1.5 ug/ml]Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged MGC21874 is approximately 0.3ng/ml as a capture antibody.ELISA
-
Gene Info — TADA2B
-
Interactome
-
Disease
-
Publication Reference
-
The double histone acetyltransferase complex ATAC is essential for mammalian development.
Guelman S, Kozuka K, Mao Y, Pham V, Solloway MJ, Wang J, Wu J, Lill JR, Zha J.
Molecular and Cellular Biology 2009 Mar; 29(5):1176.
Application:WB, Human, HEK 293 cells.
-
The double histone acetyltransferase complex ATAC is essential for mammalian development.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com