ZNF461 purified MaxPab mouse polyclonal antibody (B01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Tissue lysate)
GIOT-1 MaxPab polyclonal antibody. Western Blot analysis of GIOT-1 expression in human liver.
Western Blot (Cell lysate)
ZNF461 MaxPab polyclonal antibody. Western Blot analysis of ZNF461 expression in Jurkat.
Western Blot (Transfected lysate)
Western Blot analysis of ZNF461 expression in transfected 293T cell line (H00092283-T01) by ZNF461 MaxPab polyclonal antibody.
Lane 1: GIOT-1 transfected lysate(61.93 KDa).
Lane 2: Non-transfected lysate.
Immunofluorescence
Immunofluorescence of purified MaxPab antibody to ZNF461 on HepG2 cell. [antibody concentration 10 ug/ml]
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length human ZNF461 protein.
Immunogen
ZNF461 (NP_694989.2, 1 a.a. ~ 563 a.a) full-length human protein.
Sequence
MAHELVMFRDVAIDVSQEEWECLNPAQRNLYKEVMLENYSNLVSLGLSVSKPAVISSLEQGKEPWMVVREETGRWCPGTWKTWGFHNNFLDNNEATDINADLASRDEPQKLSPKRDIYETELSQWVNMEEFKSHSPERSIFSAIWEGNCHFEQHQGQEEGYFRQLMINHENMPIFSQHTLLTQEFYDREKISECKKCRKIFSYHLFFSHHKRTHSKELSECKECTEIVNTPCLFKQQTIQNGDKCNECKECWKAFVHCSQLKHLRIHNGEKRYECNECGKAFNYGSELTLHQRIHTGEKPYECKECGKAFRQRSQLTQHQRLHTGEKPYECKQCGKAFIRGFQLTEHLRLHTGEKPYECKECGKTFRHRSHLTIHQRIHTGEKPYECRECGKAFSYHSSFSHHQKIHSGKKPYECHECGKAFCDGLQLTLHQRIHTGEKPYECKECGKTFRQCSHLKRHQRIHTGEKPHECMICGKAFRLHSHLIQHQRIHTGEKPYECKECGKAFSYHSSFSHHQRIHSGKKPYQCGKAFNHRLQLNLHQTLHTGEKPVRFPLLPPHPSLAS
Host
Mouse
Reactivity
Human
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
GIOT-1 MaxPab polyclonal antibody. Western Blot analysis of GIOT-1 expression in human liver.Western Blot (Cell lysate)
ZNF461 MaxPab polyclonal antibody. Western Blot analysis of ZNF461 expression in Jurkat.Western Blot (Transfected lysate)
Western Blot analysis of ZNF461 expression in transfected 293T cell line (H00092283-T01) by ZNF461 MaxPab polyclonal antibody.
Lane 1: GIOT-1 transfected lysate(61.93 KDa).
Lane 2: Non-transfected lysate.
Immunofluorescence
Immunofluorescence of purified MaxPab antibody to ZNF461 on HepG2 cell. [antibody concentration 10 ug/ml] -
Gene Info — ZNF461
Entrez GeneID
92283GeneBank Accession#
NM_153257.2Protein Accession#
NP_694989.2Gene Name
ZNF461
Gene Alias
GIOT-1, GIOT1, MGC33911
Gene Description
zinc finger protein 461
Omim ID
608640Gene Ontology
HyperlinkOther Designations
gonadotropin inducible transcription repressor 1
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com