ZNF160 (Human) Recombinant Protein (P01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human ZNF160 full-length ORF ( ENSP00000347273, 1 a.a. - 147 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
MALTQVRLTFRDVAIEFSQEEWKCLDPAQRILYRDVMLENYWNLVSLGLCHFDMNIISMLEEGKEPWTVKSCVKIARKPRTPECVKGVVTDLLRRWKHWLLLLGICCPKPHGRVSSRLRLSRSLGHFFHSAFATFMGVCDKRVGSIF
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
43.5
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — ZNF160
Entrez GeneID
90338GeneBank Accession#
ENST00000355147Protein Accession#
ENSP00000347273Gene Name
ZNF160
Gene Alias
DKFZp686B16128, F11, FLJ00032, HKr18, HZF5, KIAA1611, KR18
Gene Description
zinc finger protein 160
Omim ID
600398Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a Kruppel-related zinc finger protein which is characterized by the presence of an N-terminal repressor domain, the Kruppel-associated box (KRAB). The KRAB domain is a potent repressor of transcription; thus this protein may function in transcription regulation. Three alternative transcripts encoding the same protein have been described. [provided by RefSeq
Other Designations
KRAB zinc finger protein KR18
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com