TSLP (Human) Recombinant Protein (P01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human TSLP full-length ORF ( NP_612561.1, 1 a.a. - 60 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
MKTKAALAIWCPGYSETQINATQAMKKRRKRKVTTNKCLEQVSQLQGLWRRFNRPLLKQQ
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
33.5
Interspecies Antigen Sequence
Mouse (42)
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — TSLP
Entrez GeneID
85480GeneBank Accession#
NM_138551.2Protein Accession#
NP_612561.1Gene Name
TSLP
Gene Alias
-
Gene Description
thymic stromal lymphopoietin
Omim ID
607003Gene Ontology
HyperlinkGene Summary
This gene encodes a hemopoietic cytokine proposed to signal through a heterodimeric receptor complex composed of the thymic stromal lymphopoietin receptor and the IL-7R alpha chain. It mainly impacts myeloid cells and induces the release of T cell-attracting chemokines from monocytes and enhances the maturation of CD11c(+) dendritic cells. Alternative splicing of this gene results in two transcript variants. [provided by RefSeq
Other Designations
-
-
Pathway
-
Disease
-
Publication Reference
-
TSLP/TSLPR promote angiogenesis following ischemic stroke via activation of the PI3K/AKT pathway.
Yu X, Peng Y, Liang H, Fu K, Zhao Z, Xie C, Zhou L, Zhang K.
Molecular Medicine Reports 2018 Feb; 17(2):3411.
Application:Induction, Recombinant protein.
-
TSLP/TSLPR promote angiogenesis following ischemic stroke via activation of the PI3K/AKT pathway.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com