DGCR6L MaxPab mouse polyclonal antibody (B01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length human DGCR6L protein.
Immunogen
DGCR6L (AAH00682, 1 a.a. ~ 220 a.a) full-length human protein.
Sequence
MERYAAALEEVADGARQQERHYQLLSALQSLVKELPSSFQQRLSYTTLSDLALALLDGTVFEIVQGLLEIQHLTEKSLYNQRLRLQNEHRVLRQALRQKHQEAQQACRPHNLPVVQAAQQRELEAVEHRIREEQRAMDQKIILELDRKVADQQSTLEKAGVAGFYVTTNPQELMLQMNLLELIRKLQQRGCRAGNAALGLGGPWQSPAAQCDQKGSPVPP
Host
Mouse
Reactivity
Human
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of DGCR6L expression in transfected 293T cell line (H00085359-T01) by DGCR6L MaxPab polyclonal antibody.
Lane 1: DGCR6L transfected lysate(24.2 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — DGCR6L
Entrez GeneID
85359GeneBank Accession#
BC000682Protein Accession#
AAH00682Gene Name
DGCR6L
Gene Alias
FLJ10666
Gene Description
DiGeorge syndrome critical region gene 6-like
Omim ID
609459Gene Ontology
HyperlinkGene Summary
This gene, the result of a duplication at this locus, is one of two functional genes encoding nearly identical proteins that have similar expression patterns. The product of this gene is a protein that shares homology with the Drosophila gonadal protein, expressed in gonadal tissues and germ cells, and with the human laminin gamma-1 chain that functions in cell attachment and migration. This gene is located in a region of chromosome 22 implicated in the DiGeorge syndrome, one facet of a broader collection of anomalies referred to as the CATCH 22 syndrome. [provided by RefSeq
Other Designations
DiGeorge syndrome critical region gene 6 like
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com