USP45 monoclonal antibody (M01), clone 1H2
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant USP45.
Immunogen
USP45 (XP_371838, 106 a.a. ~ 196 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
FKSSRTEPHCIIINLSTWIIWCYECDEKLSTHCNKKVLAQIVDFLQKHASKTQTSAFSRIMKLCEEKCETDEIQKGGKCRNLSVRGITNLG
Host
Mouse
Reactivity
Human, Mouse, Rat
Interspecies Antigen Sequence
Mouse (78); Rat (76)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (35.75 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
USP45 monoclonal antibody (M01), clone 1H2. Western Blot analysis of USP45 expression in human pancreas.Western Blot (Cell lysate)
USP45 monoclonal antibody (M01), clone 1H2. Western Blot analysis of USP45 expression in PC-12.Western Blot (Cell lysate)
USP45 monoclonal antibody (M01), clone 1H2. Western Blot analysis of USP45 expression in A-431 ( Cat # L015V1 ).Western Blot (Cell lysate)
USP45 monoclonal antibody (M01), clone 1H2. Western Blot analysis of USP45 expression in NIH/3T3.Western Blot (Cell lysate)
USP45 monoclonal antibody (M01), clone 1H2. Western Blot analysis of USP45 expression in HeLa.Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to USP45 on formalin-fixed paraffin-embedded human small Intestine. [antibody concentration 3 ug/ml]Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged USP45 is 0.3 ng/ml as a capture antibody.ELISA
-
Gene Info — USP45
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com