KIRREL3 monoclonal antibody (M02), clone 3A12
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged KIRREL3 is 0.3 ng/ml as a capture antibody.
Western Blot detection against Immunogen (36.74 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant KIRREL3.
Immunogen
KIRREL3 (NP_115920.1, 679 a.a. ~ 778 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
YSTLSGQGRLYDYGQRFVLGMGSSSIELCEREFQRGSLSDSSSFLDTQCDSSVSSSGKQDGYVQFDKASKASASSSHHSQSSSQNSDPSRPLQRRMQTHV
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (100); Rat (100)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.74 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged KIRREL3 is 0.3 ng/ml as a capture antibody.ELISA
-
Gene Info — KIRREL3
Entrez GeneID
84623GeneBank Accession#
NM_032531Protein Accession#
NP_115920.1Gene Name
KIRREL3
Gene Alias
KIAA1867, KIRRE, MGC126824, MGC126850, NEPH2, PRO4502
Gene Description
kin of IRRE like 3 (Drosophila)
Omim ID
607761Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a member of the nephrin-like protein family. These proteins are expressed in fetal and adult brain, and also in podocytes of kidney glomeruli. The cytoplasmic domains of these proteins interact with the C-terminus of podocin, also expressed in the podocytes, cells involved in ensuring size- and charge-selective ultrafiltration. Mutations in this gene are associated with mental retardation autosomal dominant type 4 (MRD4). Alternatively spliced transcript variants encoding different isoforms have been found for this gene
Other Designations
kin of IRRE like 3
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com