MGC13096 monoclonal antibody (M01), clone 5F9
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
MGC13096 monoclonal antibody (M01), clone 5F9. Western Blot analysis of MGC13096 expression in Raw 264.7 ( Cat # L024V1 ).
Western Blot (Cell lysate)
MGC13096 monoclonal antibody (M01), clone 5F9. Western Blot analysis of MGC13096 expression in PC-12 ( Cat # L012V1 ).
Western Blot (Cell lysate)
MGC13096 monoclonal antibody (M01), clone 5F9. Western Blot analysis of MGC13096 expression in NIH/3T3 ( Cat # L018V1 ).
Western Blot (Cell lysate)
MGC13096 monoclonal antibody (M01), clone 5F9 Western Blot analysis of MGC13096 expression in HeLa ( Cat # L013V1 ).
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged MGC13096 is approximately 0.1ng/ml as a capture antibody.
Immunofluorescence
Immunofluorescence of monoclonal antibody to MGC13096 on HeLa cell. [antibody concentration 10 ug/ml]
Western Blot detection against Immunogen (36.63 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant MGC13096.
Immunogen
MGC13096 (AAH06146, 80 a.a. ~ 179 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
CACPGCSTGGARSWKVFRSQCLQVPEREAQDAQKQGNSLAAEDWCEGADDWGSDTEEGPSPQFTLDFGNDASSAKDVDWTARLQDLRLQDAVLGAAHPVP
Host
Mouse
Reactivity
Human, Mouse, Rat
Interspecies Antigen Sequence
Mouse (59); Rat (57)
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.63 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
MGC13096 monoclonal antibody (M01), clone 5F9. Western Blot analysis of MGC13096 expression in Raw 264.7 ( Cat # L024V1 ).Western Blot (Cell lysate)
MGC13096 monoclonal antibody (M01), clone 5F9. Western Blot analysis of MGC13096 expression in PC-12 ( Cat # L012V1 ).Western Blot (Cell lysate)
MGC13096 monoclonal antibody (M01), clone 5F9. Western Blot analysis of MGC13096 expression in NIH/3T3 ( Cat # L018V1 ).Western Blot (Cell lysate)
MGC13096 monoclonal antibody (M01), clone 5F9 Western Blot analysis of MGC13096 expression in HeLa ( Cat # L013V1 ).Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged MGC13096 is approximately 0.1ng/ml as a capture antibody.ELISA
Immunofluorescence
Immunofluorescence of monoclonal antibody to MGC13096 on HeLa cell. [antibody concentration 10 ug/ml] -
Gene Info — PDCD2L
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com