PCGF6 purified MaxPab mouse polyclonal antibody (B01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length human PCGF6 protein.
Immunogen
PCGF6 (AAH07602.1, 1 a.a. ~ 277 a.a) full-length human protein.
Sequence
MEGVAVVTAGSVGAAKTEGAAALPPPPPPPVSPPALTPAPAAGEEGPAPLSETGAPGCSGSRPPELEPERSLGRFRGRFEDEDEELEEEEELEEEEEEEEEDMSHFSLRLEGGRQDSEDEEERLINLSELTPYILCSICKGYLIDATTITECLHTFCKSCIVRHFYYSNRCPKCNIVVHQTQPLYNISANEGTGHFKPLEKKFVRVSGEATIGHVEKFLRRKMGLDPACQVDIICGDHLLEQYQTLREIRRAIGDAAMQDGLLVLHYGLVVSPLKIT
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (87); Rat (86)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of PCGF6 expression in transfected 293T cell line (H00084108-T01) by PCGF6 MaxPab polyclonal antibody.
Lane 1: PCGF6 transfected lysate(30.47 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — PCGF6
Entrez GeneID
84108GeneBank Accession#
BC007602.1Protein Accession#
AAH07602.1Gene Name
PCGF6
Gene Alias
MBLR, MGC15678, MGC17541, RNF134
Gene Description
polycomb group ring finger 6
Omim ID
607816Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene contains a RING finger motif, which is most closely related to those of polycomb group (PcG) proteins RNF110/MEL-18 and BMI1. PcG proteins are known to form protein complexes and function as transcription repressors. This protein has been shown to interact with some PcG proteins and act as a transcription repressor. The activity of this protein is found to be regulated by cell cycle dependent phosphorylation. Alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq
Other Designations
Mel18 and Bmi1-like RING finger protein|OTTHUMP00000020394|OTTHUMP00000020395|ring finger protein 134
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com