ARL6 purified MaxPab mouse polyclonal antibody (B01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of ARL6 expression in transfected 293T cell line (H00084100-T01) by ARL6 MaxPab polyclonal antibody.
Lane 1: ARL6 transfected lysate(20.46 KDa).
Lane 2: Non-transfected lysate.
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length human ARL6 protein.
Immunogen
ARL6 (NP_115522.1, 1 a.a. ~ 186 a.a) full-length human protein.
Sequence
MGLLDRLSVLLGLKKKEVHVLCLGLDNSGKTTIINKLKPSNAQSQNILPTIGFSIEKFKSSSLSFTVFDMSGQGRYRNLWEHYYKEGQAIIFVIDSSDRLRMVVAKEELDTLLNHPDIKHRRIPILFFANKMDLRDAVTSVKVSQLLCLENIKDKPWHICASDAIKGEGLQEGVDWLQDQIQTVKT
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (95); Rat (95)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of ARL6 expression in transfected 293T cell line (H00084100-T01) by ARL6 MaxPab polyclonal antibody.
Lane 1: ARL6 transfected lysate(20.46 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — ARL6
Entrez GeneID
84100GeneBank Accession#
NM_032146.3Protein Accession#
NP_115522.1Gene Name
ARL6
Gene Alias
BBS3, MGC32934
Gene Description
ADP-ribosylation factor-like 6
Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene belongs to the ARF family of GTP-binding proteins. ARF proteins are important regulators of cellular traffic and are the founding members of an expanding family of homologous proteins and genomic sequences. They depart from other small GTP-binding proteins by a unique structural device that implements front-back communication from the N-terminus to the nucleotide-binding site. Studies of the mouse ortholog of this protein suggest an involvement in protein transport, membrane trafficking, or cell signaling during hematopoietic maturation. Alternative splicing occurs at this locus and two transcript variants encoding the same protein have been described. [provided by RefSeq
Other Designations
-
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com