TLR10 monoclonal antibody (M01), clone 2A11
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a full length recombinant TLR10.
Immunogen
TLR10 (NP_112218.2, 1 a.a. ~ 811 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
DAPELPEERELMTNCSNMSLRKVPADLTPATTTLDLSYNLLFQLQSSDFHSVSKLRVLILCHNRIQQLDLKTFEFNKELRYLDLSNNRLKSVTWYLLAGLRYLDLSFNDFDTMPICEEAGNMSHLEILGLSGAKIQKSDFQKIAHLHLNTVFLGFRTLPHYEEGSLPILNTTKLHIVLPMDTNFWVLLRDGIKTSKILEMTNIDGKSQFVSYEMQRNLSLENAKTSVLLLNKVDLLWDDLFLILQFVWHTSVEHF
Host
Mouse
Reactivity
Human, Mouse, Rat
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (87.27 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
TLR10 monoclonal antibody (M01), clone 2A11. Western Blot analysis of TLR10 expression in Raw 264.7 ( Cat # L024V1 ).Western Blot (Cell lysate)
TLR10 monoclonal antibody (M01), clone 2A11. Western Blot analysis of TLR10 expression in NIH/3T3 ( Cat # L018V1 ).Western Blot (Cell lysate)
TLR10 monoclonal antibody (M01), clone 2A11 Western Blot analysis of TLR10 expression in PC-12 ( Cat # L012V1 ).Western Blot (Recombinant protein)
ELISA
-
Gene Info — TLR10
Entrez GeneID
81793GeneBank Accession#
N/AProtein Accession#
NP_112218.2Gene Name
TLR10
Gene Alias
CD290, MGC104967, MGC126398, MGC126399
Gene Description
toll-like receptor 10
Omim ID
606270Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a member of the Toll-like receptor (TLR) family which plays a fundamental role in pathogen recognition and activation of innate immunity. TLRs are highly conserved from Drosophila to humans and share structural and functional similarities. They recognize pathogen-associated molecular patterns (PAMPs) that are expressed on infectious agents, and mediate the production of cytokines necessary for the development of effective immunity. The various TLRs exhibit different patterns of expression. This gene is most highly expressed in lymphoid tissues such as spleen, lymph node, thymus, and tonsil. Its exact function is not known. Multiple alternatively spliced transcript variants encoding the same protein have been found for this gene. [provided by RefSeq
Other Designations
OTTHUMP00000158729
-
Interactome
-
Disease
-
Publication Reference
-
Recognition of Double-Stranded RNA and Regulation of Interferon Pathway by Toll-Like Receptor 10.
Lee SM, Yip TF, Yan S, Jin DY, Wei HL, Guo RT, Peiris JSM.
Frontiers in Immunology 2018 Mar; 9:516.
Application:IF, WB, Human, THP-1 cells.
-
Recognition of Double-Stranded RNA and Regulation of Interferon Pathway by Toll-Like Receptor 10.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com