CDADC1 monoclonal antibody (M01), clone 1A2
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant CDADC1.
Immunogen
CDADC1 (NP_112173, 423 a.a. ~ 514 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
KCPCDECVPLIKGAGIKQIYAGDVDVGKKKADISYMRFGELEGVSKFTWQLNPSGAYGLEQNEPERRENGVLRPVPQKEEQHQDKKLRLGIH
Host
Mouse
Reactivity
Human, Mouse
Interspecies Antigen Sequence
Mouse (89)
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (35.86 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
CDADC1 monoclonal antibody (M01), clone 1A2. Western Blot analysis of CDADC1 expression in NIH/3T3 ( Cat # L018V1 ).Western Blot (Cell lysate)
CDADC1 monoclonal antibody (M01), clone 1A2. Western Blot analysis of CDADC1 expression in Raw 264.7.Western Blot (Transfected lysate)
Western Blot analysis of CDADC1 expression in transfected 293T cell line by CDADC1 monoclonal antibody (M01), clone 1A2.
Lane 1: CDADC1 transfected lysate(58.5 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to CDADC1 on formalin-fixed paraffin-embedded human kidney. [antibody concentration 1 ug/ml]Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged CDADC1 is approximately 0.03ng/ml as a capture antibody.ELISA
RNAi Knockdown (Antibody validated)
Western blot analysis of CDADC1 over-expressed 293 cell line, cotransfected with CDADC1 Validated Chimera RNAi ( Cat # H00081602-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with CDADC1 monoclonal antibody (M01), clone 1A2 (Cat # H00081602-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control. -
Gene Info — CDADC1
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com