RNF122 monoclonal antibody (M01), clone 5E5
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of RNF122 expression in transfected 293T cell line by RNF122 monoclonal antibody (M01), clone 5E5.
Lane 1: RNF122 transfected lysate(17.475 KDa).
Lane 2: Non-transfected lysate.
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged RNF122 is approximately 1ng/ml as a capture antibody.
Western Blot detection against Immunogen (36.19 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant RNF122.
Immunogen
RNF122 (NP_079063, 61 a.a. ~ 155 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
SKLRNQAQSERYGYKEVVLKGDAKKLQLYGQTCAVCLEDFKGKDELGVLPCQHAFHRKCLVKWLEVRCVCPMCNKPIASPSEATQNIGILLDELV
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (96)
Isotype
IgG2b Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.19 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of RNF122 expression in transfected 293T cell line by RNF122 monoclonal antibody (M01), clone 5E5.
Lane 1: RNF122 transfected lysate(17.475 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged RNF122 is approximately 1ng/ml as a capture antibody.ELISA
-
Gene Info — RNF122
Entrez GeneID
79845GeneBank Accession#
NM_024787Protein Accession#
NP_079063Gene Name
RNF122
Gene Alias
FLJ12526, MGC126622
Gene Description
ring finger protein 122
Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene contains a RING finger, a motif present in a variety of functionally distinct proteins and known to be involved in protein-protein and protein-DNA interactions. [provided by RefSeq
Other Designations
-
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com