PPP1R3B purified MaxPab mouse polyclonal antibody (B01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Tissue lysate)
PPP1R3B MaxPab polyclonal antibody. Western Blot analysis of PPP1R3B expression in rat brain.
Western Blot (Transfected lysate)
Western Blot analysis of PPP1R3B expression in transfected 293T cell line (H00079660-T01) by PPP1R3B MaxPab polyclonal antibody.
Lane 1: PPP1R3B transfected lysate(31.46 KDa).
Lane 2: Non-transfected lysate.
Immunofluorescence
Immunofluorescence of purified MaxPab antibody to PPP1R3B on HeLa cell. [antibody concentration 10 ug/ml]
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length human PPP1R3B protein.
Immunogen
PPP1R3B (AAH43388.1, 1 a.a. ~ 285 a.a) full-length human protein.
Sequence
MMAVDIEYRYNCMAPSLRQERFAFKISPKPSKPLRPCIQLSSKNEASGMVAPAVQEKKVKKRVSFADNQGLALTMVKVFSEFDDPLDMPFNITELLDNIVSLTTAESESFVLDFSQPSADYLDFRNRLQADHVCLENCVLKDKAIAGTVKVQNLAFEKTVKIRMTFDTWKSYTDFPCQYVKDTYAGSDRDTFSFDISLPEKIQSYERMEFAVYYECNGQTYWDSNRGKNYRIIRAELKSTQGMTKPHSGPDLGISFDQFGSPRCSYGLFPEWPSYLGYEKLGPYY
Host
Mouse
Reactivity
Human, Rat
Interspecies Antigen Sequence
Mouse (89); Rat (89)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
PPP1R3B MaxPab polyclonal antibody. Western Blot analysis of PPP1R3B expression in rat brain.Western Blot (Transfected lysate)
Western Blot analysis of PPP1R3B expression in transfected 293T cell line (H00079660-T01) by PPP1R3B MaxPab polyclonal antibody.
Lane 1: PPP1R3B transfected lysate(31.46 KDa).
Lane 2: Non-transfected lysate.
Immunofluorescence
Immunofluorescence of purified MaxPab antibody to PPP1R3B on HeLa cell. [antibody concentration 10 ug/ml] -
Gene Info — PPP1R3B
Entrez GeneID
79660GeneBank Accession#
BC043388.1Protein Accession#
AAH43388.1Gene Name
PPP1R3B
Gene Alias
FLJ14005, FLJ34675, GL, PPP1R4
Gene Description
protein phosphatase 1, regulatory (inhibitor) subunit 3B
Omim ID
610541Gene Ontology
HyperlinkGene Summary
The protein phosphatase-1 (PP1) catalytic subunit (PPP1CA; MIM 176875) is regulated by targeting subunits, such as PP1R3B. PP1R3B suppresses the rate at which PP1 dephosphorylates (i.e., inactivates) glycogen phosphorylase (see PYGL; MIM 232700) and enhances the rate at which it activates glycogen synthase (see GYS2; MIM 138571) (Doherty et al., 1995 [PubMed 7498521]).[supplied by OMIM
Other Designations
-
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com