SPAG16 monoclonal antibody (M01), clone 1D2
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a full-length recombinant SPAG16.
Immunogen
SPAG16 (NP_001020607.1, 1 a.a. ~ 183 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MAAQRGMPSSAVRVLEEALGMGLTAAGDARDTADAVAAEGAYYLEQVTITEASEDDYEYEEIPDDNFSIPEGEEDLAKAIQMAQEQATDTEILERKTVLPSKHAVPEVIEDFLCNFLIKMGMTRTLDCFQSEWYELIQKGVTELRTVGNVPDVYTQIMLLENENKNLKKDLKHYKQAAEYVIF
Host
Mouse
Reactivity
Human, Rat
Interspecies Antigen Sequence
Mouse (68); Rat (35)
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (47 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
SPAG16 monoclonal antibody (M01), clone 1D2. Western Blot analysis of SPAG16 expression in rat brain.Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged SPAG16 is 0.1 ng/ml as a capture antibody.ELISA
-
Gene Info — SPAG16
Entrez GeneID
79582GeneBank Accession#
NM_001025436.1Protein Accession#
NP_001020607.1Gene Name
SPAG16
Gene Alias
DKFZp666P1710, FLJ22724, FLJ37717, MGC87036, PF20, WDR29
Gene Description
sperm associated antigen 16
Gene Ontology
HyperlinkGene Summary
Cilia and flagella are comprised of a microtubular backbone, the axoneme, which is organized by the basal body and surrounded by plasma membrane. SPAG16 encodes 2 major proteins that associate with the axoneme of sperm tail and the nucleus of postmeiotic germ cells, respectively (Zhang et al., 2007 [PubMed 17699735]).[supplied by OMIM
Other Designations
WD repeat domain 29|sperm-associated WD repeat protein
-
Interactome
-
Disease
-
Publication Reference
-
CCDC146 is required for sperm flagellum biogenesis and male fertility in mice.
Yanjie Ma, Bingbing Wu, Yinghong Chen, Shuang Ma, Liying Wang, Tingting Han, Xiaolei Lin, Fulin Yang, Chao Liu, Jianguo Zhao, Wei Li.
Cellular and Molecular Life Sciences : CMLS 2023 Dec; 81(1):1.
Application:WB, Mouse, NIH3T3 cells.
-
CCDC176 stabilizes microtubule doublets 1 and 9 to ensure proper sperm movement.
Chao Liu, Qianchun Wang, Lusheng Gu, Xiuge Wang, Yingying Yin, Tao Huang, Sai Xiao, Shuwen Zhang, Fuqiang Wang, Tao Zhou, Guangqiong Xu, Liying Wang, Fucheng Dong, Jing Jiang, Mengcheng Luo, Jinsong Li, Haobo Zhang, Zi-Jiang Chen, Wei Ji, Baohua Ji, Hongbin Liu, Wei Li.
Current Biology : CB 2023 Jul; 33(16):3371.
Application:IF, WB-Ti, Mouse, Mouse spermatozoa.
-
CCDC146 is required for sperm flagellum biogenesis and male fertility in mice.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com