KCTD15 purified MaxPab mouse polyclonal antibody (B01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Tissue lysate)
KCTD15 MaxPab polyclonal antibody. Western Blot analysis of KCTD15 expression in rat brain.
Western Blot (Transfected lysate)
Western Blot analysis of KCTD15 expression in transfected 293T cell line (H00079047-T02) by KCTD15 MaxPab polyclonal antibody.
Lane 1: KCTD15 transfected lysate(25.74 KDa).
Lane 2: Non-transfected lysate.
Immunofluorescence
Immunofluorescence of purified MaxPab antibody to KCTD15 on HeLa cell. [antibody concentration 10 ug/ml]
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length human KCTD15 protein.
Immunogen
KCTD15 (NP_076981.1, 1 a.a. ~ 234 a.a) full-length human protein.
Sequence
MPHRKERPSGSSLHTHGSTGTAEGGNMSRLSLTRSPVSPLAAQGIPLPAQLTKSNAPVHIDVGSHMYTSSLATLTKYPDSRISRLFNGTEPIVLDSLKQHYFIDRDGEIFRYVLSFLRTSKLLLPDDFKDFSLLYEEARYYQLQPMVRELERWQQEQEQRRRSRACDCLVVRVTPDLGERIALSGEKALIEEVFPETGDVMCNSVNAGWNQDPTHVIRFPLNGYCRLNSVQDVL
Host
Mouse
Reactivity
Human, Rat
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
KCTD15 MaxPab polyclonal antibody. Western Blot analysis of KCTD15 expression in rat brain.Western Blot (Transfected lysate)
Western Blot analysis of KCTD15 expression in transfected 293T cell line (H00079047-T02) by KCTD15 MaxPab polyclonal antibody.
Lane 1: KCTD15 transfected lysate(25.74 KDa).
Lane 2: Non-transfected lysate.
Immunofluorescence
Immunofluorescence of purified MaxPab antibody to KCTD15 on HeLa cell. [antibody concentration 10 ug/ml] -
Gene Info — KCTD15
Entrez GeneID
79047GeneBank Accession#
NM_024076Protein Accession#
NP_076981.1Gene Name
KCTD15
Gene Alias
MGC25497, MGC2628
Gene Description
potassium channel tetramerisation domain containing 15
Gene Ontology
HyperlinkOther Designations
-
-
Interactome
-
Disease
-
Publication Reference
-
The BTB-Containing Protein Kctd15 Is SUMOylated In Vivo.
Zarelli VE, Dawid IB.
PLoS One 2013 Sep; 8(9):e75016.
Application：WB, Human, HEK 293T cells.
-
Inhibition of neural crest formation by Kctd15 involves regulation of transcription factor AP-2.
Zarelli VE, Dawid IB.
PNAS 2013 Feb; 110(8):2870.
Application：WB, Human, HEK293 cells, Hela cells.
-
The BTB-Containing Protein Kctd15 Is SUMOylated In Vivo.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com