LHX5 monoclonal antibody (M05), clone 2B11
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant LHX5.
Immunogen
LHX5 (NP_071758, 136 a.a. ~ 235 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
CTDRSLSPDLQDALQDDPKETDNSTSSDKETANNENEEQNSGTKRRGPRTTIKAKQLETLKAAFAATPKPTRHIREQLAQETGLNMRVIQVWFQNRRSKE
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (98); Rat (98)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.74 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
LHX5 monoclonal antibody (M05), clone 2B11 Western Blot analysis of LHX5 expression in Jurkat ( Cat # L017V1 ).Western Blot (Cell lysate)
LHX5 monoclonal antibody (M05), clone 2B11. Western Blot analysis of LHX5 expression in MES-SA/Dx5 ( Cat # L021V1 ).Western Blot (Cell lysate)
LHX5 monoclonal antibody (M05), clone 2B11. Western Blot analysis of LHX5 expression in Y-79 ( Cat # L042V1 ).Western Blot (Cell lysate)
LHX5 monoclonal antibody (M05), clone 2B11. Western Blot analysis of LHX5 expression in 293 ( Cat # L026V1 ).Western Blot (Recombinant protein)
ELISA
Immunofluorescence
Immunofluorescence of monoclonal antibody to LHX5 on HeLa cell. [antibody concentration 10 ug/ml] -
Gene Info — LHX5
Entrez GeneID
64211GeneBank Accession#
NM_022363Protein Accession#
NP_071758Gene Name
LHX5
Gene Alias
MGC129689
Gene Description
LIM homeobox 5
Omim ID
605992Gene Ontology
HyperlinkGene Summary
This gene encodes a protein belonging to a large protein family, members of which carry the LIM domain, a unique cysteine-rich zinc-binding domain. The encoded protein may function as a transcriptional regulator and be involved in the control of differentiation and development of the forebrain. In mice, this protein is essential for the regulation of precursor cell proliferation and the control of neuronal differentiation and migration during hippocampal development. This protein is involved in learning and motor functions in adult mice. [provided by RefSeq
Other Designations
LIM homeobox protein 5
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com