DUSP21 purified MaxPab mouse polyclonal antibody (B01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Tissue lysate)
DUSP21 MaxPab polyclonal antibody. Western Blot analysis of DUSP21 expression in human colon.
Western Blot (Transfected lysate)
Western Blot analysis of DUSP21 expression in transfected 293T cell line (H00063904-T01) by DUSP21 MaxPab polyclonal antibody.
Lane 1: DUSP21 transfected lysate(20.9 KDa).
Lane 2: Non-transfected lysate.
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length human DUSP21 protein.
Immunogen
DUSP21 (NP_071359.2, 1 a.a. ~ 190 a.a) full-length human protein.
Sequence
MTASASSFSSSQGVQQPSIYSFSQITRSLFLSNGVAANDKLLLSSNRITAIVNASVEVVNVFFEGIQYIKVPVTDARDSRLYDFFDPIADLIHTIDMRQGRTLLHCMAGVSRSASLCLAYLMKYHSMSLLDAHTWTKSRRPIIRPNNGFWEQLINYEFKLFNNNTVRMINSPVGNIPDIYEKDLRTMISM
Host
Mouse
Reactivity
Human
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
DUSP21 MaxPab polyclonal antibody. Western Blot analysis of DUSP21 expression in human colon.Western Blot (Transfected lysate)
Western Blot analysis of DUSP21 expression in transfected 293T cell line (H00063904-T01) by DUSP21 MaxPab polyclonal antibody.
Lane 1: DUSP21 transfected lysate(20.9 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — DUSP21
Entrez GeneID
63904GeneBank Accession#
NM_022076.2Protein Accession#
NP_071359.2Gene Name
DUSP21
Gene Alias
LMWDSP21, MGC149878
Gene Description
dual specificity phosphatase 21
Omim ID
300678Gene Ontology
HyperlinkGene Summary
This gene encodes a member of the dual specificity phosphatase family, specifically the low molecular weight dual specificity phosphatase family. The encoded protein localizes to both the cytoplasm and the nucleus and functions to remove phosphate groups from phosphotyrosine and phosphothreonine residues
Other Designations
low molecular weight dual specificity phosphatase 21
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com