PKNOX2 monoclonal antibody (M01), clone 4B6
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
PKNOX2 monoclonal antibody (M01), clone 4B6 Western Blot analysis of PKNOX2 expression in Hela S3 NE ( Cat # L013V3 ).
Western Blot (Cell lysate)
PKNOX2 monoclonal antibody (M01), clone 4B6. Western Blot analysis of PKNOX2 expression in NIH/3T3 ( Cat # L018V1 ).
Western Blot (Transfected lysate)
Western Blot analysis of PKNOX2 expression in transfected 293T cell line by PKNOX2 monoclonal antibody (M01), clone 4B6.
Lane 1: PKNOX2 transfected lysate(51.9 KDa).
Lane 2: Non-transfected lysate.
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged PKNOX2 is 0.03 ng/ml as a capture antibody.
RNAi Knockdown (Antibody validated)
Western blot analysis of PKNOX2 over-expressed 293 cell line, cotransfected with PKNOX2 Validated Chimera RNAi ( Cat # H00063876-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with PKNOX2 monoclonal antibody (M01), clone 4B6 (Cat # H00063876-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.
Immunofluorescence
Immunofluorescence of monoclonal antibody to PKNOX2 on HeLa cell. [antibody concentration 10 ug/ml]
Western Blot detection against Immunogen (36.74 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant PKNOX2.
Immunogen
PKNOX2 (NP_071345, 116 a.a. ~ 215 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
PELDNLMVKAIQVLRIHLLELEKVNELCKDFCNRYITCFKTKMHSDNLLRNDLGGPYSPNQPSINLHSQDLLQNSPNSMSGVSNNPQGIVVPASALQQGN
Host
Mouse
Reactivity
Human, Mouse
Interspecies Antigen Sequence
Mouse (98); Rat (97)
Isotype
IgG2b Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.74 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
PKNOX2 monoclonal antibody (M01), clone 4B6 Western Blot analysis of PKNOX2 expression in Hela S3 NE ( Cat # L013V3 ).Western Blot (Cell lysate)
PKNOX2 monoclonal antibody (M01), clone 4B6. Western Blot analysis of PKNOX2 expression in NIH/3T3 ( Cat # L018V1 ).Western Blot (Transfected lysate)
Western Blot analysis of PKNOX2 expression in transfected 293T cell line by PKNOX2 monoclonal antibody (M01), clone 4B6.
Lane 1: PKNOX2 transfected lysate(51.9 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged PKNOX2 is 0.03 ng/ml as a capture antibody.ELISA
RNAi Knockdown (Antibody validated)
Western blot analysis of PKNOX2 over-expressed 293 cell line, cotransfected with PKNOX2 Validated Chimera RNAi ( Cat # H00063876-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with PKNOX2 monoclonal antibody (M01), clone 4B6 (Cat # H00063876-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.Immunofluorescence
Immunofluorescence of monoclonal antibody to PKNOX2 on HeLa cell. [antibody concentration 10 ug/ml] -
Gene Info — PKNOX2
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com