APOBEC3G (Human) Recombinant Protein (Q01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human APOBEC3G partial ORF ( NP_068594, 80 a.a. - 181 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
LHRDQEYEVTWYISWSPCTKCTRDMATFLAEDPKVTLTIFVARLYYFWDPDYQEALRSLCQKRDGPRATMKIMNYDEFQHCWSKFVYSQRELFEPWNNLPKY
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
36.96
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — APOBEC3G
Entrez GeneID
60489GeneBank Accession#
NM_021822Protein Accession#
NP_068594Gene Name
APOBEC3G
Gene Alias
ARP9, CEM15, FLJ12740, MDS019, bK150C2.7, dJ494G10.1
Gene Description
apolipoprotein B mRNA editing enzyme, catalytic polypeptide-like 3G
Omim ID
607113Gene Ontology
HyperlinkGene Summary
This gene is a member of the cytidine deaminase gene family. It is one of seven related genes or pseudogenes found in a cluster, thought to result from gene duplication, on chromosome 22. Members of the cluster encode proteins that are structurally and functionally related to the C to U RNA-editing cytidine deaminase APOBEC1. It is thought that the proteins may be RNA editing enzymes and have roles in growth or cell cycle control. The protein encoded by this gene has been found to be a specific inhibitor of human immunodeficiency virus-1 (HIV-1) infectivity. [provided by RefSeq
Other Designations
DNA dC->dU editing enzyme|OTTHUMP00000028911|phorbolin-like protein MDS019
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com