SRPRB MaxPab mouse polyclonal antibody (B01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Tissue lysate)
SRPRB MaxPab polyclonal antibody. Western Blot analysis of SRPRB expression in human kidney.
Western Blot (Transfected lysate)
Western Blot analysis of SRPRB expression in transfected 293T cell line (H00058477-T01) by SRPRB MaxPab polyclonal antibody.
Lane 1: SRPRB transfected lysate(29.81 KDa).
Lane 2: Non-transfected lysate.
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length human SRPRB protein.
Immunogen
SRPRB (NP_067026, 1 a.a. ~ 271 a.a) full-length human protein.
Sequence
MASADSRRVADGGGAGGTFQPYLDTLRQELQQTDPTLLSVVVAVLAVLLTLVFWKLIRSRRSSQRAVLLVGLCDSGKTLLFVRLLTGLYRDTQTSITDSCAVYRVNNNRGNSLTLIDLPGHESLRLQFLERFKSSARAIVFVVDSAAFQREVKDVAEFLYQVLIDSMGLKNTPSFLIACNKQDIAMAKSAKLIQQQLEKELNTLRVTRSAAPSTLDSSSTAPAQLGKKGKEFEFSQLPLKVEFLECSAKGGRGDVGSADIQDLEKWLAKIA
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (90); Rat (90)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
SRPRB MaxPab polyclonal antibody. Western Blot analysis of SRPRB expression in human kidney.Western Blot (Transfected lysate)
Western Blot analysis of SRPRB expression in transfected 293T cell line (H00058477-T01) by SRPRB MaxPab polyclonal antibody.
Lane 1: SRPRB transfected lysate(29.81 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — SRPRB
Entrez GeneID
58477GeneBank Accession#
NM_021203Protein Accession#
NP_067026Gene Name
SRPRB
Gene Alias
APMCF1
Gene Description
signal recognition particle receptor, B subunit
Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene has similarity to mouse protein which is a subunit of the signal recognition particle receptor (SR). This subunit is a transmembrane GTPase belonging to the GTPase superfamily. It anchors alpha subunit, a peripheral membrane GTPase, to the ER membrane. SR is required for the cotranslational targeting of both secretory and membrane proteins to the ER membrane. [provided by RefSeq
Other Designations
signal recognition particle receptor, beta subunit
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com