POLD4 monoclonal antibody (M10), clone 2C11
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of POLD4 expression in transfected 293T cell line by POLD4 monoclonal antibody (M10), clone 2C11.
Lane 1: POLD4 transfected lysate (Predicted MW: 12.4 KDa).
Lane 2: Non-transfected lysate.
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged POLD4 is approximately 1ng/ml as a capture antibody.
Western Blot detection against Immunogen (29.48 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a full length recombinant POLD4.
Immunogen
POLD4 (AAH01334, 1 a.a. ~ 34 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MGRKRLITDSYPVVKRREGPAGHSKGELAPELGL
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (82); Rat (82)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (29.48 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of POLD4 expression in transfected 293T cell line by POLD4 monoclonal antibody (M10), clone 2C11.
Lane 1: POLD4 transfected lysate (Predicted MW: 12.4 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged POLD4 is approximately 1ng/ml as a capture antibody.ELISA
-
Gene Info — POLD4
Entrez GeneID
57804GeneBank Accession#
BC001334Protein Accession#
AAH01334Gene Name
POLD4
Gene Alias
POLDS, p12
Gene Description
polymerase (DNA-directed), delta 4
Omim ID
611525Gene Ontology
HyperlinkGene Summary
The DNA polymerase delta complex is involved in DNA replication and repair, and it consists of the proliferating cell nuclear antigen (PCNA; MIM 176740), the multisubunit replication factor C (see MIM 102579), and the 4 subunit polymerase complex: POLD1 (MIM 174761), POLD2 (MIM 600815), POLD3 (MIM 611415), and POLD4 (Liu and Warbrick, 2006 [PubMed 16934752]).[supplied by OMIM
Other Designations
DNA polymerase delta smallest subunit p12
-
Interactome
-
Pathway
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com