KIAA1530 purified MaxPab mouse polyclonal antibody (B01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length human KIAA1530 protein.
Immunogen
KIAA1530 (AAH21930.1, 1 a.a. ~ 260 a.a) full-length human protein.
Sequence
MDEEVSDPTSAAAQLRQLRDHLPPPSSASPSRALPEPQEAQKLAAERARAPVVPYGVDLHYWGQELPTAGKIVKSDSQHRFWKPSEVEEEVVNADISEMLRSRHITFAGKFEPVQHWCRAPRPDGRLCERQDRLKCPFHGKIVPRDDEGRPLDPEDRAREQRRQLQKQERPEWQDPELMRDVEAATGQDLGSSRYSGKGRGKKRRYPSLTNLKAQADTARARIGRKVFAKAAVRRVVAAMNRMDQKKHEKFSNQFNYALN
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (74); Rat (72)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of KIAA1530 expression in transfected 293T cell line (H00057654-T01) by KIAA1530 MaxPab polyclonal antibody.
Lane 1: KIAA1530 transfected lysate(28.6 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — KIAA1530
Entrez GeneID
57654GeneBank Accession#
BC021930Protein Accession#
AAH21930.1Gene Name
KIAA1530
Gene Alias
MGC117169
Gene Description
KIAA1530
Gene Ontology
HyperlinkOther Designations
hypothetical protein LOC57654
-
Interactome
-
Publication Reference
-
Ubiquitination of DNA Damage-Stalled RNAPII Promotes Transcription-Coupled Repair.
Yuka Nakazawa, Yuichiro Hara, Yasuyoshi Oka, Okiru Komine, Diana van den Heuvel, Chaowan Guo, Yasukazu Daigaku, Mayu Isono, Yuxi He, Mayuko Shimada, Kana Kato, Nan Jia, Satoru Hashimoto, Yuko Kotani, Yuka Miyoshi, Miyako Tanaka, Akira Sobue, Norisato Mitsutake, Takayoshi Suganami, Akio Masuda, Kinji Ohno, Shinichiro Nakada, Tomoji Mashimo, Koji Yamanaka, Martijn S Luijsterburg, Tomoo Ogi.
Cell 2020 Mar; 180(6):1228.
Application:WB-Tr, Human, HeLa cells.
-
Mutations in UVSSA cause UV-sensitive syndrome and impair RNA polymerase IIo processing in transcription-coupled nucleotide-excision repair.
Nakazawa Y, Sasaki K, Mitsutake N, Matsuse M, Shimada M, Nardo T, Takahashi Y, Ohyama K, Ito K, Mishima H, Nomura M, Kinoshita A, Ono S, Takenaka K, Masuyama R, Kudo T, Slor H, Utani A, Tateishi S, Yamashita S, Stefanini M, Lehmann AR, Yoshiura K, Ogi T.
Nature Genetics 2012 May; 44(5):586.
Application:IF, WB, Human, 48BR, Kps3 cells.
-
Ubiquitination of DNA Damage-Stalled RNAPII Promotes Transcription-Coupled Repair.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com