SRGAP1 monoclonal antibody (M07), clone 5D10
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant SRGAP1.
Immunogen
SRGAP1 (NP_065813, 952 a.a. ~ 1050 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
PLDPETIAQDIEETMNTALNELRELERQSTAKHAPDVVLDTLEQVKNSPTPATSTESLSPLHNVALRSSEPQIRRSTSSSSDTMSTFKPMVAPRMGVQL
Host
Mouse
Reactivity
Human, Mouse
Interspecies Antigen Sequence
Mouse (97); Rat (97)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.63 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
SRGAP1 monoclonal antibody (M07), clone 5D10. Western Blot analysis of SRGAP1 expression in IMR-32(Cat # L008V1 ).Western Blot (Cell lysate)
SRGAP1 monoclonal antibody (M07), clone 5D10. Western Blot analysis of SRGAP1 expression in NIH/3T3(Cat # L018V1 ).Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged SRGAP1 is 0.03 ng/ml as a capture antibody.ELISA
Immunofluorescence
Immunofluorescence of monoclonal antibody to SRGAP1 on HeLa cell . [antibody concentration 10 ug/ml] -
Gene Info — SRGAP1
-
Interactome
-
Pathway
-
Publication Reference
-
Mutations of the SLIT2–ROBO2 pathway genes SLIT2 and SRGAP1 confer risk for congenital anomalies of the kidney and urinary tract.
Hwang DY, Kohl S, Fan X, Vivante A, Chan S, Dworschak GC, Schulz J, van Eerde AM, Hilger AC, Gee HY, Pennimpede T, Herrmann BG, van de Hoek G, Renkema KY, Schell C, Huber TB, Reutter HM, Soliman NA, Stajic N, Bogdanovic R, Kehinde EO, Lifton RP, Tasic V, Lu W, Hildebrandt F.
Human Genetics 2015 Aug; 134(8):905.
Application:WB-Tr, Human, HEK 293 cells .
-
Mutations of the SLIT2–ROBO2 pathway genes SLIT2 and SRGAP1 confer risk for congenital anomalies of the kidney and urinary tract.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com