NDRG2 (Human) Recombinant Protein (Q01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human NDRG2 partial ORF ( NP_057334, 1 a.a. - 96 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
MAELQEVQITEEKPLLPGQTPEAAKTHSVETPYGSVTFTVYGTPKPKRPAILTYHDVGLNYKSCFQPLFQFEDMQEIIQNFVRVHVDAPGMEEGAP
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
36.3
Interspecies Antigen Sequence
Mouse (92); Rat (92)
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — NDRG2
Entrez GeneID
57447GeneBank Accession#
NM_016250Protein Accession#
NP_057334Gene Name
NDRG2
Gene Alias
DKFZp781G1938, FLJ25522, KIAA1248, SYLD
Gene Description
NDRG family member 2
Omim ID
605272Gene Ontology
HyperlinkGene Summary
This gene is a member of the N-myc downregulated gene family which belongs to the alpha/beta hydrolase superfamily. The protein encoded by this gene is a cytoplasmic protein that may play a role in neurite outgrowth. This gene may be involved in glioblastoma carcinogenesis. Several alternatively spliced transcript variants of this gene have been described, but the full-length nature of some of these variants has not been determined. [provided by RefSeq
Other Designations
N-myc downstream regulator 2|N-myc downstream-regulated gene 2|NDR1-related protein NDR2|OTTHUMP00000164407|cytoplasmic protein Ndr1|syld709613 protein
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com