DAZ3 polyclonal antibody (A01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse polyclonal antibody raised against a partial recombinant DAZ3.
Immunogen
DAZ3 (NP_065097, 387 a.a. ~ 438 a.a) partial recombinant protein with GST tag.
Sequence
YPNSAVQVTTGYQFHVYNYQMPPQCPVGEQRRNLWTEAYKWWYLVCLIQRRD
Host
Mouse
Reactivity
Human
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (31.83 KDa) .
Storage Buffer
50 % glycerol
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
DAZ3 polyclonal antibody (A01), Lot # 061025JCS1 Western Blot analysis of DAZ3 expression in U-2 OS ( Cat # L022V1 ).Western Blot (Recombinant protein)
ELISA
-
Gene Info — DAZ3
Entrez GeneID
57054GeneBank Accession#
NM_020364Protein Accession#
NP_065097Gene Name
DAZ3
Gene Alias
MGC126441, pDP1679
Gene Description
deleted in azoospermia 3
Omim ID
400027Gene Ontology
HyperlinkGene Summary
This gene is a member of the DAZ gene family and is a candidate for the human Y-chromosomal azoospermia factor (AZF). Its expression is restricted to premeiotic germ cells, particularly in spermatogonia. It encodes an RNA-binding protein that is important for spermatogenesis. Four copies of this gene are found on chromosome Y within palindromic duplications; one pair of genes is part of the P2 palindrome and the second pair is part of the P1 palindrome. Each gene contains a 2.4 kb repeat including a 72-bp exon, called the DAZ repeat; the number of DAZ repeats is variable and there are several variations in the sequence of the DAZ repeat. Each copy of the gene also contains a 10.8 kb region that may be amplified; this region includes five exons that encode an RNA recognition motif (RRM) domain. This gene contains one copy of the 10.8 kb repeat. [provided by RefSeq
Other Designations
OTTHUMP00000042590
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com