CABC1 monoclonal antibody (M04A), clone 7G1
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant CABC1.
Immunogen
CABC1 (AAH05171, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MAAILGDTIMVAKGLVKLTQAAVETHLQHLGIGGELIMAARALQSTAVEQIGMFLGKVQGQDKHEEYFAENFGGPEGEFHFSVPHAAGASTDFSSASAPD
Host
Mouse
Reactivity
Human, Mouse, Rat
Interspecies Antigen Sequence
Mouse (86); Rat (87)
Isotype
IgM Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.63 KDa) .
Storage Buffer
In ascites fluid
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
CABC1 monoclonal antibody (M04A), clone 7G1 Western Blot analysis of CABC1 expression in Hela S3 NE ( Cat # L013V3 ).Western Blot (Recombinant protein)
ELISA
-
Gene Info — CABC1
Entrez GeneID
56997GeneBank Accession#
BC005171Protein Accession#
AAH05171Gene Name
CABC1
Gene Alias
ADCK3, ARCA2, COQ8, MGC4849, SCAR9
Gene Description
chaperone, ABC1 activity of bc1 complex homolog (S. pombe)
Omim ID
606980Gene Ontology
HyperlinkGene Summary
This gene encodes a mitochondrial protein similar to yeast ABC1, which functions in an electron-transferring membrane protein complex in the respiratory chain. It is not related to the family of ABC transporter proteins. Expression of this gene is induced by the tumor suppressor p53 and in response to DNA damage, and inhibiting its expression partially suppresses p53-induced apoptosis. Alternatively spliced transcript variants have been found; however, their full-length nature has not been determined. [provided by RefSeq
Other Designations
OTTHUMP00000035734|OTTHUMP00000035737|chaperone, ABC1 activity of bc1 complex like|chaperone-ABC1 (activity of bc1 complex, S.pombe)-like|chaperone-ABC1-like|coenzyme Q8 homolog
-
Interactome
-
Publication Reference
-
Reduction in the levels of CoQ biosynthetic proteins is related to an increase in lifespan without evidence of hepatic mitohormesis.
Rodríguez-Hidalgo M, Luna-Sánchez M, Hidalgo-Gutiérrez A, Barriocanal-Casado E, Mascaraque C, Acuña-Castroviejo D, Rivera M, Escames G, López LC.
Scientific Reports 2018 Sep; 8(1):14013.
Application:WB-Ti, Mouse, Liver.
-
Decreased Coenzyme Q10 Levels in Multiple System Atrophy Cerebellum.
Barca E, Kleiner G, Tang G, Ziosi M, Tadesse S, Masliah E, Louis ED, Faust P, Kang UJ, Torres J, Cortes EP, Vonsattel JG, Kuo SH, Quinzii CM.
Journal of Neuropathology and Experimental Neurology 2016 Jul; 75(7):663.
Application:WB-Ti, Human, Cerebellar.
-
The clinical heterogeneity of coenzyme Q10 deficiency results from genotypic differences in the Coq9 gene.
Luna-Sanchez M, Diaz-Casado E, Barca E, Tejada MA, Montilla-Garcia A, Cobos EJ, Escames G, Acuna-Castroviejo D, Quinzii CM, Lopez LC.
EMBO Molecular Medicine 2015 May; 7(5):670.
Application:WB, Human, Mouse, Cerebrum, Kidney, Muscle, Skin fibroblasts.
-
Reduction in the levels of CoQ biosynthetic proteins is related to an increase in lifespan without evidence of hepatic mitohormesis.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com