DUSP22 monoclonal antibody (M01), clone 3D3
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of DUSP22 expression in transfected 293T cell line by DUSP22 monoclonal antibody (M01), clone 3D3.
Lane 1: DUSP22 transfected lysate(20.9 KDa).
Lane 2: Non-transfected lysate.
RNAi Knockdown (Antibody validated)
Western blot analysis of DUSP22 over-expressed 293 cell line, cotransfected with DUSP22 Validated Chimera RNAi ( Cat # H00056940-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with DUSP22 monoclonal antibody (M01), clone 3D3 (Cat # H00056940-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.
Western Blot detection against Immunogen (33.77 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant DUSP22.
Immunogen
DUSP22 (NP_064570, 112 a.a. ~ 184 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
EDALHTVRAGRSCANPNVGFQRQLQEFEKHEVHQYRQWLKEEYGESPLQDAEEAKNILAAPGILKFWAFLRRL
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (93); Rat (91)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (33.77 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of DUSP22 expression in transfected 293T cell line by DUSP22 monoclonal antibody (M01), clone 3D3.
Lane 1: DUSP22 transfected lysate(20.9 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
ELISA
RNAi Knockdown (Antibody validated)
Western blot analysis of DUSP22 over-expressed 293 cell line, cotransfected with DUSP22 Validated Chimera RNAi ( Cat # H00056940-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with DUSP22 monoclonal antibody (M01), clone 3D3 (Cat # H00056940-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control. -
Gene Info — DUSP22
Entrez GeneID
56940GeneBank Accession#
NM_020185Protein Accession#
NP_064570Gene Name
DUSP22
Gene Alias
JKAP, JSP1, MKPX, VHX
Gene Description
dual specificity phosphatase 22
Gene Ontology
HyperlinkOther Designations
JNK-stimulating phosphatase 1|OTTHUMP00000015938|homolog of mouse dual specificity phosphatase LMW-DSP2|mitogen-activated protein kinase phosphatase x
-
Interactome
-
Publication Reference
-
DUSP22 suppresses prostate cancer proliferation by targeting the EGFR-AR axis.
Lin HP, Ho HM, Chang CW, Yeh SD, Su YW, Tan TH, Lin WJ.
FASEB Journal 2019 Dec; 33(12):14653.
Application：WB, Human, C4-2B, CWR22Rv1, LNCaP cells.
-
Promoter hypermethylation of the phosphatase DUSP22 mediates PKA-dependent TAU phosphorylation and CREB activation in Alzheimer's disease.
Sanchez-Mut JV, Aso E, Heyn H, Matsuda T, Bock C, Ferrer I, Esteller M.
Hippocampus 2014 Apr; 24(4):363.
Application：WB, Human, Brain.
-
JNK Pathway-associated Phosphatase Dephosphorylates Focal Adhesion Kinase and Suppresses Cell Migration.
Li JP, Fu YN, Chen YR, Tan TH.
The Journal of Biological Chemistry 2010 Feb; 285(8):5472.
Application：WB, Human, H1299 cells.
-
DUSP22 suppresses prostate cancer proliferation by targeting the EGFR-AR axis.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com