MMP26 monoclonal antibody (M01), clone 6C6
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant MMP26.
Immunogen
MMP26 (NP_068573, 152 a.a. ~ 261 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
SFWQWAHEDGWPFDGPGGILGHAFLPNSGNPGVVHFDKNEHWSASDTGYNLFLVATHEIGHSLGLQHSGNQSSIMYPTYWYHDPRTFQLSADDIQRIQHLYGEKCSSDIP
Host
Mouse
Reactivity
Human
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37.84 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
MMP26 monoclonal antibody (M01), clone 6C6 Western Blot analysis of MMP26 expression in HL-60 ( Cat # L014V1 ).Western Blot (Cell lysate)
MMP26 monoclonal antibody (M01), clone 6C6. Western Blot analysis of MMP26 expression in HeLa(Cat # L013V1 ).Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged MMP26 is approximately 1ng/ml as a capture antibody.ELISA
-
Gene Info — MMP26
Entrez GeneID
56547GeneBank Accession#
NM_021801Protein Accession#
NP_068573Gene Name
MMP26
Gene Alias
MGC126590, MGC126592
Gene Description
matrix metallopeptidase 26
Omim ID
605470Gene Ontology
HyperlinkGene Summary
Proteins of the matrix metalloproteinase (MMP) family are involved in the breakdown of extracellular matrix in normal physiological processes, such as embryonic development, reproduction, and tissue remodeling, as well as in disease processes, such as arthritis and metastasis. Most MMP's are secreted as inactive proproteins which are activated when cleaved by extracellular proteinases. The encoded protein degrades type IV collagen, fibronectin, fibrinogen, casein, vitronectin, alpha 1-antitrypsin, alpha 2-macroglobulin, and insulin-like growth factor-binding protein 1, and activates MMP9 by cleavage. The protein differs from most MMP family members in that it lacks a conserved C-terminal protein domain. [provided by RefSeq
Other Designations
OTTHUMP00000069244|endometase|matrilysin 2|matrix metalloproteinase 26
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com