PCDHAC2 monoclonal antibody (M03), clone 3D12

Catalog # H00056134-M03

Size

Price

Stock

Quantity

Size:100 ug
Price: USD $ 335.00
Stock:
order now, ship next day
abnova-minus
abnova-plus

* The price is valid only in USA. Please select country.

Contact Info
  • +1-909-264-1399
    +1-909-992-0619
    Toll Free : +1-877-853-6098
  • +1-909-992-3401
Images
Western Blot (Transfected lysate)
Application

Western Blot (Transfected lysate)

Western Blot analysis of PCDHAC2 expression in transfected 293T cell line by PCDHAC2 monoclonal antibody (M03), clone 3D12.

Lane 1: PCDHAC2 transfected lysate(96.2 KDa).
Lane 2: Non-transfected lysate.

RNAi Knockdown (Antibody validated)
Application

RNAi Knockdown (Antibody validated)

Western blot analysis of PCDHAC2 over-expressed 293 cell line, cotransfected with PCDHAC2 Validated Chimera RNAi ( Cat # H00056134-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with PCDHAC2 monoclonal antibody (M03), clone 3D12 (Cat # H00056134-M03 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.

QC Test

Western Blot detection against Immunogen (37.84 KDa) .

  • Specification

    Product Description

    Mouse monoclonal antibody raised against a partial recombinant PCDHAC2.

    Immunogen

    PCDHAC2 (NP_061722, 81 a.a. ~ 190 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

    Sequence

    HLGAPSPRYLELDLTSGALFVNERIDREALCEQRPRCLLSLEVLAHNPVAVSAVEVEILDINDNSPRFPRPNYQLQVSESVAPGARFHIESAQDPDVGANSVQTYELSPS

    Host

    Mouse

    Reactivity

    Human

    Interspecies Antigen Sequence

    Mouse (92); Rat (92)

    Isotype

    IgG2a Kappa

    Quality Control Testing

    Antibody Reactive Against Recombinant Protein.

    Western Blot detection against Immunogen (37.84 KDa) .

    Storage Buffer

    In 1x PBS, pH 7.4

    Storage Instruction

    Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.

  • Applications

    Western Blot (Transfected lysate)

    Western Blot analysis of PCDHAC2 expression in transfected 293T cell line by PCDHAC2 monoclonal antibody (M03), clone 3D12.

    Lane 1: PCDHAC2 transfected lysate(96.2 KDa).
    Lane 2: Non-transfected lysate.

    Western Blot (Recombinant protein)

    ELISA

    RNAi Knockdown (Antibody validated)

    Western blot analysis of PCDHAC2 over-expressed 293 cell line, cotransfected with PCDHAC2 Validated Chimera RNAi ( Cat # H00056134-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with PCDHAC2 monoclonal antibody (M03), clone 3D12 (Cat # H00056134-M03 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.
  • Gene Info — PCDHAC2

    Entrez GeneID

    56134

    GeneBank Accession#

    NM_018899

    Protein Accession#

    NP_061722

    Gene Name

    PCDHAC2

    Gene Alias

    MGC71598, PCDH-ALPHA-C2

    Gene Description

    protocadherin alpha subfamily C, 2

    Omim ID

    606321

    Gene Ontology

    Hyperlink

    Gene Summary

    This gene is a member of the protocadherin alpha gene cluster, one of three related gene clusters tandemly linked on chromosome five that demonstrate an unusual genomic organization similar to that of B-cell and T-cell receptor gene clusters. The alpha gene cluster is composed of 15 cadherin superfamily genes related to the mouse CNR genes and consists of 13 highly similar and 2 more distantly related coding sequences. The tandem array of 15 N-terminal exons, or variable exons, are followed by downstream C-terminal exons, or constant exons, which are shared by all genes in the cluster. The large, uninterrupted N-terminal exons each encode six cadherin ectodomains while the C-terminal exons encode the cytoplasmic domain. These neural cadherin-like cell adhesion proteins are integral plasma membrane proteins that most likely play a critical role in the establishment and function of specific cell-cell connections in the brain. Alternative splicing has been observed and additional variants have been suggested but their full-length nature has yet to be determined. [provided by RefSeq

    Other Designations

    -

  • Interactome
Contact Info
  • +1-909-264-1399
    +1-909-992-0619
    Toll Free : +1-877-853-6098
  • +1-909-992-3401
4 Products to Compare
Remove All